KEGG   Oenococcus oeni: OEOE_0745Help
Entry
OEOE_0745         CDS       T00408                                 

Definition
(GenBank) Threonine dehydrogenase-like Zn-dependent dehydrogenase
Organism
ooe  Oenococcus oeni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABJ56677
UniProt: Q04FU5
LinkDB All DBs
Position
695866..696948
Genome map
AA seq 360 aa AA seqDB search
MTMVKAAVIYGPKDIRFEKRNIPDPAPDEVQIEVAFNGICGSDIHEYLEGMDLATMPHPL
THMQAPLIPGHEFSGTISKIGKQVSKLRIGDKVAVEPMIACGKCPECLSGHYNWCEHAIG
SDQSAGFLGFSANGGLAEKCNVKSTFAHLLPTDFPLDLGALVEPVSVAAQAVMASRVSPG
DDVLIQGAGPIGLFTALIAQISGAHHVIINDMSEERLDLANELGVQYPIRADSQKSLAHA
ISTITENQGVDVAFDCAGVQPTLTGAIQALKNGGKVTVIALFQHPPVVDVRALLKKGGSL
LTSYGYANIFDRVIKIIDTYRSLFKRVITKKIELNELVSEGIESLEKDKKQAKILVRLHS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactatggtgaaagcagctgttatttacggtcctaaggatatccgctttgaaaaaaga
aatattcctgatccggcaccagatgaagttcaaattgaggttgcatttaatggtatttgt
ggtagtgatattcatgaatatttagagggtatggatttggcgacaatgcctcatccgcta
acccatatgcaggctccgctaattcctggtcatgaattctctgggacgatttctaaaatt
ggaaaacaagtatctaaattaagaattggagataaagttgcagtcgagccaatgattgct
tgtggaaaatgtccggaatgtctttctggtcattataattggtgtgagcatgctataggt
agtgatcaatcagcaggattcttaggattttcggctaacggtggtttagctgaaaagtgc
aatgtaaaaagtacctttgcacatctcttgccaactgactttccgcttgatttaggggct
ttagttgagccagtttcagttgctgcacaagcagttatggcaagccgagtgtctcctgga
gatgatgtcttaattcagggtgctggtccaattggattgttcacggccttaatagcacaa
atttctggtgcccatcacgtcataataaatgacatgtcagaggaacgtttggatttagca
aatgaattaggggttcaatacccaatacgtgctgatagccaaaagtcattagctcacgct
atcagcactatcacggaaaatcagggagtagatgttgcatttgattgtgccggtgtacaa
cccacacttactggtgccattcaggctcttaaaaacggtggcaaggttaccgtgattgca
ttatttcaacatccaccagttgtagatgttagagctcttcttaaaaagggtggtagttta
ttaacatcttatggatatgccaatatcttcgatcgagtaattaagattatagatacctat
cggtcactattcaaacgtgtcattacaaaaaagattgaattaaatgaattagtttcagaa
ggaattgaatccttagaaaaggataaaaaacaagcaaagattttagttcgtttgcattct
tag

DBGET integrated database retrieval system