KEGG   Oenococcus oeni: OEOE_0745
Entry
OEOE_0745         CDS       T00408                                 

Definition
(GenBank) Threonine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ooe  Oenococcus oeni
Pathway
ooe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OEOE_0745
Enzymes [BR:ooe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OEOE_0745
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OEOE_0745
    1.1.1.-  
     OEOE_0745
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C Methyltransf_25
Other DBs
NCBI-ProteinID: ABJ56677
UniProt: Q04FU5
LinkDB
Position
695866..696948
AA seq 360 aa
MTMVKAAVIYGPKDIRFEKRNIPDPAPDEVQIEVAFNGICGSDIHEYLEGMDLATMPHPL
THMQAPLIPGHEFSGTISKIGKQVSKLRIGDKVAVEPMIACGKCPECLSGHYNWCEHAIG
SDQSAGFLGFSANGGLAEKCNVKSTFAHLLPTDFPLDLGALVEPVSVAAQAVMASRVSPG
DDVLIQGAGPIGLFTALIAQISGAHHVIINDMSEERLDLANELGVQYPIRADSQKSLAHA
ISTITENQGVDVAFDCAGVQPTLTGAIQALKNGGKVTVIALFQHPPVVDVRALLKKGGSL
LTSYGYANIFDRVIKIIDTYRSLFKRVITKKIELNELVSEGIESLEKDKKQAKILVRLHS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgactatggtgaaagcagctgttatttacggtcctaaggatatccgctttgaaaaaaga
aatattcctgatccggcaccagatgaagttcaaattgaggttgcatttaatggtatttgt
ggtagtgatattcatgaatatttagagggtatggatttggcgacaatgcctcatccgcta
acccatatgcaggctccgctaattcctggtcatgaattctctgggacgatttctaaaatt
ggaaaacaagtatctaaattaagaattggagataaagttgcagtcgagccaatgattgct
tgtggaaaatgtccggaatgtctttctggtcattataattggtgtgagcatgctataggt
agtgatcaatcagcaggattcttaggattttcggctaacggtggtttagctgaaaagtgc
aatgtaaaaagtacctttgcacatctcttgccaactgactttccgcttgatttaggggct
ttagttgagccagtttcagttgctgcacaagcagttatggcaagccgagtgtctcctgga
gatgatgtcttaattcagggtgctggtccaattggattgttcacggccttaatagcacaa
atttctggtgcccatcacgtcataataaatgacatgtcagaggaacgtttggatttagca
aatgaattaggggttcaatacccaatacgtgctgatagccaaaagtcattagctcacgct
atcagcactatcacggaaaatcagggagtagatgttgcatttgattgtgccggtgtacaa
cccacacttactggtgccattcaggctcttaaaaacggtggcaaggttaccgtgattgca
ttatttcaacatccaccagttgtagatgttagagctcttcttaaaaagggtggtagttta
ttaacatcttatggatatgccaatatcttcgatcgagtaattaagattatagatacctat
cggtcactattcaaacgtgtcattacaaaaaagattgaattaaatgaattagtttcagaa
ggaattgaatccttagaaaaggataaaaaacaagcaaagattttagttcgtttgcattct
tag

DBGET integrated database retrieval system