KEGG   Oenococcus oeni: OEOE_1798Help
Entry
OEOE_1798         CDS       T00408                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ooe  Oenococcus oeni
Pathway
ooe00620  Pyruvate metabolism
ooe00680  Methane metabolism
ooe01100  Metabolic pathways
ooe01120  Microbial metabolism in diverse environments
ooe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OEOE_1798
  09102 Energy metabolism
   00680 Methane metabolism
    OEOE_1798
Enzymes [BR:ooe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OEOE_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: ABJ57637
UniProt: Q04D35
LinkDB All DBs
Position
complement(1715973..1717496)
Genome map
AA seq 507 aa AA seqDB search
MHKIDRKIPNIMGTQHPDNAGVPFFKGDQSKNPFITAYKEVDEAFNNFAVLDTDEYMWDW
EGKHADAAVIDRLYSEHYEYFKGHQLGRDKFLTFRLPNIWEEKGYSLMQAMTTMLSAEDF
ARDLSFEQRPLFEAILPMAQTSEQLIEIEDKFSKLAHFKSDEFTSGSNNTDHIEMIPLFE
GFKTQLHSPEILKEYLQLYEQRTGQSLPYLRVFLAGSDSALSNGFMNSIIGNKLALTRLH
EFSDQKDLPIFPIAGTGSTIFRGGLSPKWIKRYLQEFPGLKTATVQSAFRYDYPLKQVQS
AIKELRSGLQNNQAVSMTDREQNVLINVAKKSADCYHETLDQLINDLQKIFDAFPKRRDR
RQHVGILGYSRQVDGYKMPRAITFTGSLYSVGVPPEFIGFGRALMSLNAEELAIFTRHYP
NLRNDFTFLAHYISVDALESLIAKNPAWLEAKKDIQDLQSILQFEIGPSNEKEEEHSRLA
SDLVKISDPTTRTLLIQKQAVLRNFLG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatcgatagaaaaattcctaatattatgggtacgcagcatcctgataatgca
ggcgtccctttttttaaaggcgatcagagtaaaaatccctttattaccgcctataaagag
gtcgacgaggccttcaataattttgctgttttggatactgatgaatatatgtgggattgg
gaaggcaaacacgccgatgcggccgtaatcgatcgtttgtattccgaacattacgagtat
tttaaagggcatcaacttggccgcgacaaatttctgactttccgcctgccgaatatctgg
gaagaaaaaggatacagcctgatgcaggcaatgacaacaatgctttcagccgaagatttt
gccagggatctgtcttttgaacagcgtcccttgtttgaagcgattttgcccatggcgcag
acgtccgaacagttaatcgaaatcgaagacaagttttcgaaattagctcattttaaatca
gatgaatttacaagtggctcaaacaataccgatcacattgaaatgattcctttattcgag
ggatttaaaacccaattgcattcgccagagattttaaaagagtatctacaattgtatgaa
cagcgcaccggtcagtctcttccttatctgcgtgtttttttggctggttccgattcggct
ttaagtaatggatttatgaattctattattggcaataaacttgctttgactcgtttgcat
gaattttccgatcaaaaggatttaccaatttttccgatcgccggtactggttcgacgatt
ttccgcgggggattatcaccgaaatggattaaacgctatctgcaagagtttcccggctta
aaaacagcaactgttcaatcagcttttcgttacgactatccgcttaagcaagtacaatca
gccatcaaagaacttcgttcgggccttcaaaacaatcaagctgtctcgatgacagatcgg
gaacaaaacgttttaattaatgtcgccaagaaatcagcggattgttatcacgaaactctc
gatcagctgatcaatgatttacaaaaaattttcgatgcttttccaaaacgtcgcgatcgt
cgtcagcacgttggcattctcggttattcccgacaggtcgacggttacaaaatgcctcgg
gcaatcacctttaccggtagtttatactcggttggggttccaccggaatttattggtttc
ggtcgggctttaatgagcttgaatgctgaagaactggcaatatttactcgtcattatccg
aatttaaggaatgactttactttcctggcacattatattagcgtggatgcattggagagc
ttaattgctaaaaatccagcttggttggaagcaaaaaaagatattcaggacctgcaatcg
attcttcaatttgagattggcccaagcaatgaaaaagaagaagaacattctcgtttggct
tccgacttggttaagatctccgatccaacaacaagaacgcttttgattcaaaaacaagct
gtcttgaggaactttttaggttaa

DBGET integrated database retrieval system