KEGG   Orcinus orca (killer whale): 101269212
Entry
101269212         CDS       T05247                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04015  Rap1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05014  Amyotrophic lateral sclerosis
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05205  Proteoglycans in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101269212 (MAPK13)
   04015 Rap1 signaling pathway
    101269212 (MAPK13)
   04370 VEGF signaling pathway
    101269212 (MAPK13)
   04668 TNF signaling pathway
    101269212 (MAPK13)
   04068 FoxO signaling pathway
    101269212 (MAPK13)
   04071 Sphingolipid signaling pathway
    101269212 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101269212 (MAPK13)
   04218 Cellular senescence
    101269212 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101269212 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101269212 (MAPK13)
   04613 Neutrophil extracellular trap formation
    101269212 (MAPK13)
   04620 Toll-like receptor signaling pathway
    101269212 (MAPK13)
   04621 NOD-like receptor signaling pathway
    101269212 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    101269212 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    101269212 (MAPK13)
   04660 T cell receptor signaling pathway
    101269212 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    101269212 (MAPK13)
   04659 Th17 cell differentiation
    101269212 (MAPK13)
   04657 IL-17 signaling pathway
    101269212 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    101269212 (MAPK13)
   04670 Leukocyte transendothelial migration
    101269212 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101269212 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    101269212 (MAPK13)
   04917 Prolactin signaling pathway
    101269212 (MAPK13)
   04926 Relaxin signaling pathway
    101269212 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    101269212 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101269212 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    101269212 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    101269212 (MAPK13)
   04722 Neurotrophin signaling pathway
    101269212 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101269212 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101269212 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    101269212 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101269212 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101269212 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101269212 (MAPK13)
   05020 Prion disease
    101269212 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    101269212 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101269212 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101269212 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101269212 (MAPK13)
   05135 Yersinia infection
    101269212 (MAPK13)
   05133 Pertussis
    101269212 (MAPK13)
   05152 Tuberculosis
    101269212 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101269212 (MAPK13)
   05161 Hepatitis B
    101269212 (MAPK13)
   05171 Coronavirus disease - COVID-19
    101269212 (MAPK13)
   05163 Human cytomegalovirus infection
    101269212 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101269212 (MAPK13)
   05169 Epstein-Barr virus infection
    101269212 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101269212 (MAPK13)
   05140 Leishmaniasis
    101269212 (MAPK13)
   05142 Chagas disease
    101269212 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101269212 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101269212 (MAPK13)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101269212 (MAPK13)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101269212 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 101269212
NCBI-ProteinID: XP_004267721
LinkDB
Position
Unknown
AA seq 366 aa
MNFTWKKGFYKQDVNKTAWELPKTYVSLTHVGSGAYGAVCSAIEKQSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQMDLQKIMGM
EFGEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARQADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPDAEFVQKLNDKAAKSYIQSLPQTPKKDFSQLFQHASPQAADLLEKMLELDMDKRLTAS
QALTHPFFESCRDPEEETEAQQPFDDFLEQEKLTVDEWKHHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaacttcacctggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccctgacgcacgtaggcagcggggcctacggcgccgtgtgc
tcagccatcgagaagcagtcaggggagaaggtggccatcaagaaactgagccggcccttc
cagtctgagatctttgccaagcgggcctatcgcgagctgctgctgctgaagcacatgcag
catgagaacgtcatcggactcctggatgtcttcaccccagcctcttccctgcgcaacttt
catgatttctacctggtgatgcccttcatgcagatggacctgcagaagatcatgggaatg
gagttcggtgaggacaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac
atccactcagctggggtcatccacagggacctgaagccaggcaaccttgctgtcaatgag
gattgtgagctgaagattttggattttgggttggcacggcaagcagatgcagagatgacc
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aaccagactgtggacatctggtctgtgggctgtatcatggcggagatgctgacggggaaa
actctgttcaaggggaaagattacctggaccagctgacgcagatcctgaaagtgacgggg
gtgccggacgctgagtttgtgcagaagttgaatgacaaagcggccaaatcctacatccag
tccctgccacaaacccccaagaaggatttctctcagctcttccagcatgccagcccccag
gctgcagacctgctggagaagatgctggagctggacatggacaagcgcctgaccgcctct
caggccctcacccaccccttctttgaatcctgccgggaccctgaggaggaaacagaggcc
cagcagccatttgatgatttcttagaacaggagaaactcacagtggatgaatggaagcac
cacatttacaaggagattgtgaacttcagccccatcgcccggaaggactctaggcgccgg
agtggcatgaagctccagtga

KEGG   Orcinus orca (killer whale): 101269458
Entry
101269458         CDS       T05247                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04015  Rap1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05014  Amyotrophic lateral sclerosis
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05205  Proteoglycans in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101269458 (MAPK14)
   04015 Rap1 signaling pathway
    101269458 (MAPK14)
   04370 VEGF signaling pathway
    101269458 (MAPK14)
   04668 TNF signaling pathway
    101269458 (MAPK14)
   04068 FoxO signaling pathway
    101269458 (MAPK14)
   04071 Sphingolipid signaling pathway
    101269458 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101269458 (MAPK14)
   04218 Cellular senescence
    101269458 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101269458 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101269458 (MAPK14)
   04613 Neutrophil extracellular trap formation
    101269458 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101269458 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101269458 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101269458 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101269458 (MAPK14)
   04660 T cell receptor signaling pathway
    101269458 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101269458 (MAPK14)
   04659 Th17 cell differentiation
    101269458 (MAPK14)
   04657 IL-17 signaling pathway
    101269458 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101269458 (MAPK14)
   04670 Leukocyte transendothelial migration
    101269458 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101269458 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101269458 (MAPK14)
   04917 Prolactin signaling pathway
    101269458 (MAPK14)
   04926 Relaxin signaling pathway
    101269458 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    101269458 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101269458 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    101269458 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101269458 (MAPK14)
   04722 Neurotrophin signaling pathway
    101269458 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101269458 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101269458 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    101269458 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101269458 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101269458 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101269458 (MAPK14)
   05020 Prion disease
    101269458 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    101269458 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101269458 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101269458 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101269458 (MAPK14)
   05135 Yersinia infection
    101269458 (MAPK14)
   05133 Pertussis
    101269458 (MAPK14)
   05152 Tuberculosis
    101269458 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101269458 (MAPK14)
   05161 Hepatitis B
    101269458 (MAPK14)
   05171 Coronavirus disease - COVID-19
    101269458 (MAPK14)
   05163 Human cytomegalovirus infection
    101269458 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101269458 (MAPK14)
   05169 Epstein-Barr virus infection
    101269458 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101269458 (MAPK14)
   05140 Leishmaniasis
    101269458 (MAPK14)
   05142 Chagas disease
    101269458 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101269458 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101269458 (MAPK14)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101269458 (MAPK14)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101269458 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 101269458
NCBI-ProteinID: XP_004267722
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccaaaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgttgcagtgaagaagctatccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgttttcacacctgctaggtctctggaggaattcaat
gatgtgtacctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccacgttcagttccttatctaccagattctccgaggtctcaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggattttggactggctcgacatacagatgatgaaatgaca
ggctatgtagccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acactgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccaaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcg
caagcccttgcacatgcctactttgcccagtaccacgatcctgacgatgaaccagtggct
gatccttacgatcagtctttcgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtct
tga

KEGG   Orcinus orca (killer whale): 101287579
Entry
101287579         CDS       T05247                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04015  Rap1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05014  Amyotrophic lateral sclerosis
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05205  Proteoglycans in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101287579 (MAPK12)
   04015 Rap1 signaling pathway
    101287579 (MAPK12)
   04370 VEGF signaling pathway
    101287579 (MAPK12)
   04668 TNF signaling pathway
    101287579 (MAPK12)
   04068 FoxO signaling pathway
    101287579 (MAPK12)
   04071 Sphingolipid signaling pathway
    101287579 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101287579 (MAPK12)
   04218 Cellular senescence
    101287579 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101287579 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101287579 (MAPK12)
   04613 Neutrophil extracellular trap formation
    101287579 (MAPK12)
   04620 Toll-like receptor signaling pathway
    101287579 (MAPK12)
   04621 NOD-like receptor signaling pathway
    101287579 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    101287579 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    101287579 (MAPK12)
   04660 T cell receptor signaling pathway
    101287579 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    101287579 (MAPK12)
   04659 Th17 cell differentiation
    101287579 (MAPK12)
   04657 IL-17 signaling pathway
    101287579 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    101287579 (MAPK12)
   04670 Leukocyte transendothelial migration
    101287579 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101287579 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    101287579 (MAPK12)
   04917 Prolactin signaling pathway
    101287579 (MAPK12)
   04926 Relaxin signaling pathway
    101287579 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    101287579 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101287579 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    101287579 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    101287579 (MAPK12)
   04722 Neurotrophin signaling pathway
    101287579 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101287579 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101287579 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    101287579 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101287579 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101287579 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101287579 (MAPK12)
   05020 Prion disease
    101287579 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    101287579 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101287579 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101287579 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101287579 (MAPK12)
   05135 Yersinia infection
    101287579 (MAPK12)
   05133 Pertussis
    101287579 (MAPK12)
   05152 Tuberculosis
    101287579 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101287579 (MAPK12)
   05161 Hepatitis B
    101287579 (MAPK12)
   05171 Coronavirus disease - COVID-19
    101287579 (MAPK12)
   05163 Human cytomegalovirus infection
    101287579 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101287579 (MAPK12)
   05169 Epstein-Barr virus infection
    101287579 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101287579 (MAPK12)
   05140 Leishmaniasis
    101287579 (MAPK12)
   05142 Chagas disease
    101287579 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101287579 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101287579 (MAPK12)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101287579 (MAPK12)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101287579 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like TAP42 UvrD_C
Other DBs
NCBI-GeneID: 101287579
NCBI-ProteinID: XP_004279657
LinkDB
Position
Unknown
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPNETLDDFTDFYLVMPFMGTDLGKLM
EHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGETLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSAEAQNYMNGLPELEKKDFAAILTNASPLAVNLLEKMLVLDAERRV
TAAKALTHPYFESLHDTEDEPKAQKYDESFDDVDRTLEEWKRVTYREVLSFKPPRQLGAK
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcaagggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgtaggctcgggcgcctatggcgcc
gtgtgctcggcggtggacagccgcacgggcgccaaggtggccataaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccatgagaacgtaattgggctgctggatgtgttcacacccaatgagaccctggat
gatttcacagacttttacctggtgatgccgttcatgggcaccgacctggggaagctcatg
gagcacgagaagctgagtgaggaccgaatccagttcctcgtctaccagatgctcaagggg
ctgaagtacatccatgctgctggcatcatccacagggacctgaagcccggcaacctggcc
gtgaacgaggactgtgagctcaagatcctggacttcggcctggcccggcaggcagatagc
gagatgactgggtacgtggtgacccggtggtaccgggcgcctgaggtcatcttgaattgg
atgcactacacacagacggtggacatctggtcagtgggctgcatcatggctgagatgatc
acaggggagacgctcttcaaaggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctcccgccgagttcgtgcagaggctgcagagtgccgaggctcagaac
tacatgaacggcctccccgagctagagaaaaaggattttgccgccatcctgaccaacgca
agccctctggccgtgaacctcctggagaagatgctggtgctggatgcggagcggcgggtg
acggcggccaaggcgctgacccacccctacttcgagtcgctccacgacacggaggacgag
cccaaagcccaaaagtacgatgaatcctttgatgacgtggaccgcacgctggaagagtgg
aagcgtgtcacatacagagaggtgctcagcttcaagcctccccgacagctgggggccaag
gtctccaaggagacggccctgtga

KEGG   Orcinus orca (killer whale): 101287833
Entry
101287833         CDS       T05247                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04015  Rap1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05014  Amyotrophic lateral sclerosis
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05205  Proteoglycans in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101287833 (MAPK11)
   04015 Rap1 signaling pathway
    101287833 (MAPK11)
   04370 VEGF signaling pathway
    101287833 (MAPK11)
   04668 TNF signaling pathway
    101287833 (MAPK11)
   04068 FoxO signaling pathway
    101287833 (MAPK11)
   04071 Sphingolipid signaling pathway
    101287833 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101287833 (MAPK11)
   04218 Cellular senescence
    101287833 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101287833 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101287833 (MAPK11)
   04613 Neutrophil extracellular trap formation
    101287833 (MAPK11)
   04620 Toll-like receptor signaling pathway
    101287833 (MAPK11)
   04621 NOD-like receptor signaling pathway
    101287833 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    101287833 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    101287833 (MAPK11)
   04660 T cell receptor signaling pathway
    101287833 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    101287833 (MAPK11)
   04659 Th17 cell differentiation
    101287833 (MAPK11)
   04657 IL-17 signaling pathway
    101287833 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    101287833 (MAPK11)
   04670 Leukocyte transendothelial migration
    101287833 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101287833 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    101287833 (MAPK11)
   04917 Prolactin signaling pathway
    101287833 (MAPK11)
   04926 Relaxin signaling pathway
    101287833 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    101287833 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101287833 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    101287833 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    101287833 (MAPK11)
   04722 Neurotrophin signaling pathway
    101287833 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101287833 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101287833 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    101287833 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101287833 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101287833 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101287833 (MAPK11)
   05020 Prion disease
    101287833 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    101287833 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101287833 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101287833 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101287833 (MAPK11)
   05135 Yersinia infection
    101287833 (MAPK11)
   05133 Pertussis
    101287833 (MAPK11)
   05152 Tuberculosis
    101287833 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101287833 (MAPK11)
   05161 Hepatitis B
    101287833 (MAPK11)
   05171 Coronavirus disease - COVID-19
    101287833 (MAPK11)
   05163 Human cytomegalovirus infection
    101287833 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101287833 (MAPK11)
   05169 Epstein-Barr virus infection
    101287833 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101287833 (MAPK11)
   05140 Leishmaniasis
    101287833 (MAPK11)
   05142 Chagas disease
    101287833 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101287833 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101287833 (MAPK11)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101287833 (MAPK11)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101287833 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 101287833
NCBI-ProteinID: XP_004279658
LinkDB
Position
Unknown
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDTRLRQRVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSLEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPHMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQPPGSL
DVKQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggcccgcgcgccggcttctatcggcaggagctgaacaagacggtgtgggaggtg
ccgcagcggctgcaagggctgcgcccggtgggctcgggcgcctacggctccgtctgctca
gcctacgacacgcggctgcgccagagggtggcggtgaagaagctgtcgcgccccttccag
tcgctcatccatgcgcggaggacgtaccgcgagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggctgctggacgtgttcacgccggccacctccctcgaggacttcagc
gaagtgtacctggtgaccacgctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcagttcctcgtgtaccagctgctgcgcgggctgaagtac
atccactcggcggggatcatccaccgggacctgaagcccagcaacttggctgtgaacgag
gactgcgagctgcggatcctggacttcgggctcgcgcgccaggcggacgaggagatgact
ggctacgtggccacgcgctggtaccgggcccctgagatcatgctgaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggccgagctgctccagggaaag
gcccttttcccaggaaatgactacatcgaccagctgaagcgcatcatggaggtggtgggc
acacccagccctgaggttctggcaaagatatcgtcggaacatgcccggacctacatccag
tccctgccccacatgccccagaaggacctcaggagcatcttccatggagccaaccccctg
gctgtggacctcctgggacggatgctggtgctggacagtgaccagagggtcagtgcagcc
gaggccctggcccatgcctacttcagccagtaccacgaccccgaggatgagcccgaggcc
gagccctacgacgaaagcgttgaggccaaggagcgcacggtggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccccagagccaccgcagccgcctggcagcctg
gacgttaagcagtga

DBGET integrated database retrieval system