KEGG   Orcinus orca (killer whale): 101269348
Entry
101269348         CDS       T05247                                 

Gene name
SUV420H2
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H2
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00310  Lysine degradation
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101269348 (SUV420H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101269348 (SUV420H2)
Enzymes [BR:oor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     101269348 (SUV420H2)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101269348 (SUV420H2)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 101269348
NCBI-ProteinID: XP_004283384
LinkDB
Position
Unknown
AA seq 455 aa
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRLQPKEPLPPRPMDKYELRETKRRLQQGLDGPRACAHPPPLRRDLFCAACQPLRPPPC
GARPDASPLWLQWLPQPQLRVRPRRRRRPQPRRAPAPPVLRAARVSLHRWGGCGPHCCLR
AEALVALGPAARARWAPQQDWHWARRYGLPYVVRVDLSRVAPAPPATATPVPAGTPGPIP
IPKQALAFAPFSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggccccgacagagtgacagccagggaactgtgtgagaatgacgacctcgccaccagc
ctcgtcctggacccctacctcggcttccgcacccataagatgaacgtcagccccgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccgagccttc
ctgcctgaaagcggcttcaccatcttgccctgtacccgttattccatggagacaaatgga
gccaagattgtgtctacccgcgcttggaaaaagaacgaaaagttggagctgctggtgggc
tgcatcgcagagctgcgggaggcggacgaggggctgctgagggccggggagaatgacttc
agtatcatgtactccacccgcaagcgcagcgctcagctgtggctcggcccggccgccttc
atcaaccacgactgcaaacccaactgcaagttcgtacctgcagatgggaacgcagcctgc
gtgaaggtgctccgggacatcgagccaggggacgaggtgacatgcttctacggcgaaggc
ttcttcggtgaaaagaatgagcactgtgaatgctacacctgcgagaggagaggcgaagga
gctttccgactgcagcccaaggagcccctgccgccccggcccatggacaagtatgagctc
cgggagacgaagcggcggctgcagcagggcctggatggcccccgggcctgtgcccaccca
cccccgctgcgccgggacctgttctgcgctgcctgccagcccctgcgccccccgccctgc
ggcgcccgccccgatgcctcacccctctggctccagtggctgcctcagccccagctccgg
gtgcgcccccggaggcgccgacgcccccagccccgacgggccccggcgccccccgttctc
cgtgctgcccgcgtctccctgcaccgatggggaggctgtggcccccactgctgcctgcgg
gcggaggccctagtggctctggggccggccgcccgtgcccgctgggccccccagcaggac
tggcactgggcccggcgctacgggctgccttacgtggtacgtgtggatctgagccgtgtg
gccccggccccgcctgccactgccactcccgtccccgccgggaccccaggccccatcccc
atccccaagcaggcccttgcctttgcccccttctccccacccaagcgcctgcggctcgtg
gtcagccatggctccattgacctggatgtcaacggtgatgggccgtga

DBGET integrated database retrieval system