KEGG   Orcinus orca (killer whale): 101269459
Entry
101269459         CDS       T05247                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04020  Calcium signaling pathway
oor04072  Phospholipase D signaling pathway
oor04144  Endocytosis
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04630  JAK-STAT signaling pathway
oor04810  Regulation of actin cytoskeleton
oor05163  Human cytomegalovirus infection
oor05200  Pathways in cancer
oor05206  MicroRNAs in cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101269459 (PDGFRA)
   04014 Ras signaling pathway
    101269459 (PDGFRA)
   04015 Rap1 signaling pathway
    101269459 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101269459 (PDGFRA)
   04020 Calcium signaling pathway
    101269459 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101269459 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101269459 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101269459 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101269459 (PDGFRA)
   04540 Gap junction
    101269459 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101269459 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101269459 (PDGFRA)
   05206 MicroRNAs in cancer
    101269459 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101269459 (PDGFRA)
   05231 Choline metabolism in cancer
    101269459 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101269459 (PDGFRA)
   05218 Melanoma
    101269459 (PDGFRA)
   05215 Prostate cancer
    101269459 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101269459 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101269459 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101269459 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oor04090]
    101269459 (PDGFRA)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101269459 (PDGFRA)
Protein kinases [BR:oor01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101269459 (PDGFRA)
CD molecules [BR:oor04090]
 Proteins
  101269459 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 101269459
NCBI-ProteinID: XP_004268313
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHWALLVLGCLVTGPSLILCQLSLPSILPNENERIVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRDEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQLEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVILLSSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVVTCAVFNN
EVVDLQWTYPGQVKGKGLTMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIRPNFSPLEAVNLHEVKHFVVDVQAYPPPRIAWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWLICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSMVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMV
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcgtcacagggccaagcctc
atcctctgccagctttcattaccctccatcctgcccaatgaaaacgagaggattgtccag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagggacgaggagaacaacagtggcctt
tttgtgacagtgctggaagtggtcagtgcctcggcggcccacacggggctgtacacttgc
tattacaaccacacacagttggaagaaagcgagatcgagggcagacgcatttacatctat
gtgccagacccagatgtagccttcgtgcctctaggaatgacagattacttggtcatcgtg
gaggacgatgattctgccatcatcccttgtcgaacgactgatcctgagacgccagtgatt
ttactcagcagtgacggggtggtgcacgcctcctatgacagcagacaaggctttaatgga
accttcactgtcggaccctatatctgcgaggccaccgtcagggggaagaagttccagacg
atcccattcaatgtttatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtctataaggcaggggaatcgattgtggtcacctgcgccgtctttaacaat
gaggttgtggaccttcagtggacttaccctggacaagtgaaaggcaaaggcctcacaatg
ctggaggagaccaaggtcccgtccatcaagttggtgtacactctgatggtccctgaggcc
acggtgaaagatagtggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtgcacgagaaagggtttattgaaatcagacccaac
ttcagcccgttggaagccgtcaacctgcatgaagtcaaacattttgtggtggacgtgcag
gcctacccccctcccaggatagcctggctcaaggacaacctgactctgattgagaatctc
acagagatcaccactgacatagaaaagattcaggaaatcaggtatcgaagcaaattaaag
ttgatccgagctaaggaagaagacagcggccattatactattgtagttcaaaatgaagat
gatgtgaagagctacacttttgaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaatgggggccagacagtgagatgcacagctgaaggaacc
cctcttcctgatattgagtggctgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagcatggtggagggccaagtgacattcgccaaggtggaggagaccattgcagtacga
tgcctggctaagaatctcctcggggtggagagccgagagctgaagttggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgttgttggtgattgtaatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcaactg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggc
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagtcgatcccaacct
gtcatgaaggtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcttgagccgccacccagagaag
cccaagaaagagctggacatttttggattgaaccctgctgacgaaagcacacgaagttac
gttattttatcttttgaaaacaacggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggaaaggaaagaggtttctaagtactcagacatccagagagcg
ctgtacgatcgcccagcctcatataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggcc
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtcaaaaggcagcacctttctcccggtgaag
tggatggctcccgagagcatcttcgacaacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttccctcggtggtacgccctaccctggcatggtg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcccgaccac
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgtatg
cgcgtggactccgacaatgcgtacattggcgtcacctacaaaaacgaggaggacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagcgcagacagtggctacatcatc
cctctgcctgacatcgaccctgttcctgaagaggaagacctgggcaaaaggaacagacac
agctcgcagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system