KEGG   Orcinus orca (killer whale): 101269950
Entry
101269950         CDS       T05247                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X3
  KO
K05459  insulin-like growth factor 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04114  Oocyte meiosis
oor04115  p53 signaling pathway
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04730  Long-term depression
oor04750  Inflammatory mediator regulation of TRP channels
oor04913  Ovarian steroidogenesis
oor04914  Progesterone-mediated oocyte maturation
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05205  Proteoglycans in cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05224  Breast cancer
oor05410  Hypertrophic cardiomyopathy
oor05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101269950 (IGF1)
   04014 Ras signaling pathway
    101269950 (IGF1)
   04015 Rap1 signaling pathway
    101269950 (IGF1)
   04066 HIF-1 signaling pathway
    101269950 (IGF1)
   04068 FoxO signaling pathway
    101269950 (IGF1)
   04151 PI3K-Akt signaling pathway
    101269950 (IGF1)
   04152 AMPK signaling pathway
    101269950 (IGF1)
   04150 mTOR signaling pathway
    101269950 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101269950 (IGF1)
   04115 p53 signaling pathway
    101269950 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101269950 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101269950 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101269950 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    101269950 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    101269950 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101269950 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    101269950 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101269950 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    101269950 (IGF1)
   04213 Longevity regulating pathway - multiple species
    101269950 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101269950 (IGF1)
   05202 Transcriptional misregulation in cancer
    101269950 (IGF1)
   05205 Proteoglycans in cancer
    101269950 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    101269950 (IGF1)
   05218 Melanoma
    101269950 (IGF1)
   05215 Prostate cancer
    101269950 (IGF1)
   05224 Breast cancer
    101269950 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101269950 (IGF1)
   05414 Dilated cardiomyopathy
    101269950 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101269950 (IGF1)
   01522 Endocrine resistance
    101269950 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101269950 (IGF1)
Cytokines and growth factors [BR:oor04052]
 Growth factors
  Growth factors (RTK binding)
   101269950 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 101269950
NCBI-ProteinID: XP_004269501
LinkDB
Position
Unknown
AA seq 159 aa
MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYVAVFLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKKKKSQRRRKGSTFEEHK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacatcacgtcctcctcgcatctcttctacgtggccgtgttcttgctt
accttcaccagctctgccacggctggacccgagaccctctgtggggctgagctggtggac
gcccttcagttcgtgtgcggagacaggggcttttatttcaacaagcccacggggtatggc
tcgagcagtcggagggcgcctcagacaggaatcgtggatgaatgctgcttccggagctgt
gatctgaggaggctggagatgtactgcgcgcctctcaagcctgccaagtcagcccgttct
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcagcccccatccacc
aacaagaaaaagaagtctcagaggagaaggaaaggaagtacatttgaagaacacaagtag

DBGET integrated database retrieval system