KEGG   Orcinus orca (killer whale): 101270299Help
Entry
101270299         CDS       T05247                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 isoform X1
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00590  Arachidonic acid metabolism
oor01100  Metabolic pathways
oor04064  NF-kappa B signaling pathway
oor04370  VEGF signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04668  TNF signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04726  Serotonergic synapse
oor04913  Ovarian steroidogenesis
oor04921  Oxytocin signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor05140  Leishmaniasis
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05200  Pathways in cancer
oor05204  Chemical carcinogenesis
oor05206  MicroRNAs in cancer
oor05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101270299 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101270299 (PTGS2)
   04064 NF-kappa B signaling pathway
    101270299 (PTGS2)
   04668 TNF signaling pathway
    101270299 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101270299 (PTGS2)
   04657 IL-17 signaling pathway
    101270299 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101270299 (PTGS2)
   04913 Ovarian steroidogenesis
    101270299 (PTGS2)
   04921 Oxytocin signaling pathway
    101270299 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    101270299 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    101270299 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101270299 (PTGS2)
   05206 MicroRNAs in cancer
    101270299 (PTGS2)
   05204 Chemical carcinogenesis
    101270299 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    101270299 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    101270299 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101270299 (PTGS2)
   05165 Human papillomavirus infection
    101270299 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    101270299 (PTGS2)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101270299 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 101270299
NCBI-ProteinID: XP_004275286
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MLARALLLCAALALCGAANPCCSSPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLQNMIMRYVLISRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRVLPPVPDDCPTPMGVKGRKELPDSKEVVEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTTGQSHGVDLNHVYGESLERQHKLRLFKDGKMKY
QIIGGEMYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKHEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDGQDYKYQQFVYNNSLLLEHGLTQFVESFTRQIAGRV
AGGRNLPVAVEKVSKASIDHSREMKYQSFNEYRKRFLLKPYKSFEELTGEKEMAAELEAL
YGDIDAIELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIIKTASIQSLICNNVKGCPFTSFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgcgctgctgctctgcgccgccctggcgctctgtggtgcagcaaatcct
tgctgttccagtccatgccagaatcgaggtgtatgtatgagcgtaggatttgaccagtat
aaatgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaacacagtgcactacatacttacgcac
ttcaagggagtctggaacattgtcaataacattcccttcctgcagaatatgattatgaga
tatgtgttgatatcgagatcacatctgattgacagcccgccaacttataatgtgcactac
ggctataaaagctgggaagccttttctaacctgtcctattacaccagagttcttcctcct
gtgcctgatgactgcccaacacccatgggtgtcaaagggaggaaagagcttcctgattca
aaagaagttgtggaaaaagtacttctaagaagaaagttcatccctgatccccagggcaca
aatatgatgtttgcgttctttgcccagcacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccacgggacagagccatggggtggacttaaatcatgtttat
ggtgaatctttggagagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattggtggtgaaatgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccccctcatgttcctgaacacctgcggtttgctgtggggcaggaagtcttcggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtgtgtgat
gttcttaaacatgagcatccagaatgggacgatgagcagctgttccagacgagtaggcta
atactgataggagaaactattaagattgtgattgaagactatgtacagcacctgagtggc
tatcacttcaaactgaagtttgacccagagctgctttttaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
tttcagatcgatggccaggactacaagtatcagcaatttgtctataacaactccctctta
ctggaacacggcctcactcagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatcttccagttgcagtagagaaagtatcaaaggcttcaattgaccac
agcagagagatgaaataccagtcttttaatgagtaccgcaaacgctttctgctgaagcct
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcgctc
tatggtgacattgacgccatagagctgtatcctgctctgctggtagaaaagcctcgacca
gacgccatctttggggagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgagtactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaagactgcctcaattcagtctctcatctgcaataacgtgaaaggc
tgtccttttacctcattcagtgttcaagacccacagctcaccaaaacagtcaccattaat
gcaagctcttcccactctggactagatgatatcaaccccacagtactactaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system