KEGG   Orcinus orca (killer whale): 101270342
Entry
101270342         CDS       T05247                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01523  Antifolate resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04064  NF-kappa B signaling pathway
oor04066  HIF-1 signaling pathway
oor04071  Sphingolipid signaling pathway
oor04137  Mitophagy - animal
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04218  Cellular senescence
oor04380  Osteoclast differentiation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04623  Cytosolic DNA-sensing pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04668  TNF signaling pathway
oor04722  Neurotrophin signaling pathway
oor04917  Prolactin signaling pathway
oor04920  Adipocytokine signaling pathway
oor04926  Relaxin signaling pathway
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05030  Cocaine addiction
oor05132  Salmonella infection
oor05133  Pertussis
oor05134  Legionellosis
oor05135  Yersinia infection
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05146  Amoebiasis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05203  Viral carcinogenesis
oor05212  Pancreatic cancer
oor05215  Prostate cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05321  Inflammatory bowel disease
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101270342 (RELA)
   04014 Ras signaling pathway
    101270342 (RELA)
   04064 NF-kappa B signaling pathway
    101270342 (RELA)
   04668 TNF signaling pathway
    101270342 (RELA)
   04066 HIF-1 signaling pathway
    101270342 (RELA)
   04071 Sphingolipid signaling pathway
    101270342 (RELA)
   04024 cAMP signaling pathway
    101270342 (RELA)
   04151 PI3K-Akt signaling pathway
    101270342 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101270342 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101270342 (RELA)
   04218 Cellular senescence
    101270342 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101270342 (RELA)
   04621 NOD-like receptor signaling pathway
    101270342 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101270342 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101270342 (RELA)
   04625 C-type lectin receptor signaling pathway
    101270342 (RELA)
   04660 T cell receptor signaling pathway
    101270342 (RELA)
   04658 Th1 and Th2 cell differentiation
    101270342 (RELA)
   04659 Th17 cell differentiation
    101270342 (RELA)
   04657 IL-17 signaling pathway
    101270342 (RELA)
   04662 B cell receptor signaling pathway
    101270342 (RELA)
   04062 Chemokine signaling pathway
    101270342 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101270342 (RELA)
   04917 Prolactin signaling pathway
    101270342 (RELA)
   04926 Relaxin signaling pathway
    101270342 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101270342 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101270342 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101270342 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101270342 (RELA)
   05202 Transcriptional misregulation in cancer
    101270342 (RELA)
   05203 Viral carcinogenesis
    101270342 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101270342 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101270342 (RELA)
   05221 Acute myeloid leukemia
    101270342 (RELA)
   05220 Chronic myeloid leukemia
    101270342 (RELA)
   05215 Prostate cancer
    101270342 (RELA)
   05222 Small cell lung cancer
    101270342 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101270342 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101270342 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    101270342 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101270342 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101270342 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101270342 (RELA)
   04931 Insulin resistance
    101270342 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101270342 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101270342 (RELA)
   05135 Yersinia infection
    101270342 (RELA)
   05133 Pertussis
    101270342 (RELA)
   05134 Legionellosis
    101270342 (RELA)
   05152 Tuberculosis
    101270342 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101270342 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101270342 (RELA)
   05162 Measles
    101270342 (RELA)
   05164 Influenza A
    101270342 (RELA)
   05161 Hepatitis B
    101270342 (RELA)
   05160 Hepatitis C
    101270342 (RELA)
   05168 Herpes simplex virus 1 infection
    101270342 (RELA)
   05163 Human cytomegalovirus infection
    101270342 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101270342 (RELA)
   05169 Epstein-Barr virus infection
    101270342 (RELA)
   05165 Human papillomavirus infection
    101270342 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101270342 (RELA)
   05145 Toxoplasmosis
    101270342 (RELA)
   05140 Leishmaniasis
    101270342 (RELA)
   05142 Chagas disease
    101270342 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101270342 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oor03000]
    101270342 (RELA)
Transcription factors [BR:oor03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101270342 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101270342
NCBI-ProteinID: XP_004264414
LinkDB
Position
Unknown
AA seq 595 aa
MDDLFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKVSTAPGWGTLSQYGRDLRSGPHSLCLGGEPGISEPLGFSLYFGQINGYTGPGTVRISL
VTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQT
NNNPFQVPVEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPALSHPIFDNRAPNTAELKI
CRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPP
YADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKS
PFNGPTDHRPPTRRIAVPSRSSTSVPKPPPQPYPFTPSLSTINFEEFSPMVFPSGQIPSQ
TSALAPAPALVLAQAPAPAPAMASALAQAPAPGPVLAPGLAQAVTPPAPKTNPAGEGTLT
EALLQLQFDADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVPMAPHTAEPMLMEY
PEAITRLVTGSQRPPDPVPTPLGASGLTNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggacgacctcttccccctcatcttccccgcggagccggcccaggcctccggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgctttcgctacaagtgtgagggc
cgctcagcaggcagtatcccaggcgagaggagcacagacaccaccaagacccaccctacc
atcaaggtcagcacagcgcccgggtgggggacattgagtcagtatgggagggacttgcgt
tcaggcccacacagtctgtgtctgggaggtgagcctggaatttctgagcctctagggttc
tctctgtactttggacagatcaatggttacacggggccagggacagtccgcatctccctg
gtgaccaaggacccccctcaccggcctcacccccatgagcttgtggggaaagactgccgg
gatggcttctatgaggctgagctctgcccggaccgctgcatccacagcttccagaacctg
gggatccagtgtgtaaagaagcgggacctggagcaggccatcagtcagcgcatccagacc
aacaacaaccccttccaagttcccgtagaagagcagcgtggggactacgacctgaatgct
gtccggctctgcttccaggtgacagtgcgggacccggcaggcaggcccctacgcctgtcg
cctgccctctctcatcccatctttgacaaccgcgcccccaacactgccgagctcaagatc
tgccgagtgaatcggaactctgggagctgccttgggggggatgagatcttcctgctgtgt
gacaaggtgcagaaagaggatatcgaggtgtatttcacgggaccaggctgggaggcccga
ggctccttttcacaagctgatgtgcaccggcaagtggccattgtgttccggacgcccccc
tatgcggaccccagcctgcaggcccccgtgcgcgtctccatgcagctgcggcggccttct
gatcgggagctcagcgaacccatggaattccagtacttgccagacacagatgatcgccac
cggattgaggagaaacgcaaaaggacgtatgagacctttaagagcatcatgaaaaagagc
cctttcaatggacccaccgaccaccggcctccgacccggcgcatcgctgtgccttcccgc
agctcaacttccgtccccaagccacctccccagccctatccctttacaccatctctcagc
accatcaactttgaggagttctcccccatggtctttccttctgggcagatcccaagccag
acctcggccttggcaccggcccctgccctagtcctggcccaggccccagcccctgcccca
gccatggcatcagccctggcccaggccccagcccctggccccgtcctagccccaggcctt
gctcaggctgtgaccccacctgcccccaagactaacccggctggggaagggacactgaca
gaggctctgctgcagctgcagtttgacgctgatgaagacctgggggccctgctcggcaat
agcacagatccagccgtgttcacagacctggcatccgtcgacaactctgagtttcagcag
ctgctgaaccagggtgtacccatggccccccatacagctgagcccatgctgatggagtac
cctgaggctataactcgtctggtgacagggtcccagaggccccctgacccagttcccact
cccctgggagcctctggcctcaccaacggccttctctcaggggatgaagacttctcctcc
attgcggacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system