KEGG   Orcinus orca (killer whale): 101270440Help
Entry
101270440         CDS       T05247                                 

Gene name
METAP1D
Definition
(RefSeq) LOW QUALITY PROTEIN: methionine aminopeptidase 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oor01002]
    101270440 (METAP1D)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     101270440 (METAP1D)
Peptidases [BR:oor01002]
 Metallo Peptidases
  Family M24
   101270440 (METAP1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 101270440
NCBI-ProteinID: XP_004267353
LinkDB All DBs
Position
Unknown
AA seq 467 aa AA seqDB search
MLNARLCFIFSSQLYVSMHQNVDATNIGYHAYLTGFFHPTWARGLRASARTAAGARLSRP
DRARPAAGSPTGPGARAAPPPGLPQSAPAAHAHSPSAASAPPVFGTAATGLLLRAGRGEE
GTRARGHVTDANMAAPSGVHLFVRRGCHRIFSSSLNHIYLHKQSSSQQRRNFFFRRQREI
SHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLRQACQLARHVL
LLAGKSLKVDMTTEEIDALVHQEIISHDAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRP
LQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFS
VIGNTISQITHQNGLQVCPHFVGHGIGSYFHGHPEIWHHANDSDLRMEEGMAFTVEPIIT
EGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSGGAQILTKLPHEA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacgctagattgtgctttattttttcctcccaactttacgtttccatgcaccaa
aatgttgatgctacaaatattggataccacgcttacctgacaggcttcttccatcccacc
tgggcgcgggggctcagagcgagcgcgcgaaccgcggctggagcccgtctctcgcggccg
gaccgcgctcggccggccgcgggttcccctactggccccggtgcccgagccgctccgccg
cctgggctcccgcagtcagctcccgccgcgcacgcgcactctccctctgcggcctcggcg
cctccggtcttcggcacggctgcgactggactgctcctacgggcggggcggggcgaggag
gggacgagagctcgcggccacgtgaccgacgccaacatggcggcgcccagcggcgtccac
ctgttcgtccggagaggttgtcacaggattttctcttcatcactcaatcatatctactta
cacaagcagtcaagcagtcaacaaagaagaaatttctttttccgaagacaaagagagatt
tcacacagtatagttttgccggctgcagtttcttcagctcatccagtccctaagcacata
aagaagccagactatgtgacgacaggcattgtacccgactggggagacagcatagaagtt
aagaatgaagatcagattcaagggcttcgtcaggcttgtcagctggcccgccatgtcctc
ctcctggccgggaagagtttaaaggttgacatgacaactgaagagatagatgctcttgtt
catcaggaaatcatcagtcatgatgcctatccctcacctctaggctatggaggttttcca
aaatctgtttgtacctctgtaaacaacgtgctttgtcatggtattcctgacagtcgacct
cttcaggatggagatattatcaacattgatgtcacggtttactacaatggctaccatgga
gacacctctgaaacatttttggtgggcaatgtggatgaatgtggtaaaaagttagtggag
gttgccaggaggtgtagagacgaagcaattgctgcttgcagagcgggggctcccttctct
gtaattggaaacacaatcagccagataactcatcagaatggtttgcaagtctgtccacat
tttgtgggacatgggataggatcttactttcatggacatccagaaatttggcatcatgcg
aatgacagcgatctacgcatggaggagggcatggcattcaccgtagagccaattataacc
gagggatcccctgaatttaaagtgctggaggatgcatggactgtggtctccttggacaat
caaaggtcggcccagttcgagcacacagttctcatcacgtcggggggcgcgcagatcctg
accaaactgccccacgaggcctga

DBGET integrated database retrieval system