KEGG   Orcinus orca (killer whale): 101271282
Entry
101271282         CDS       T05247                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04015  Rap1 signaling pathway
oor04145  Phagosome
oor04210  Apoptosis
oor04390  Hippo signaling pathway
oor04510  Focal adhesion
oor04520  Adherens junction
oor04530  Tight junction
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04670  Leukocyte transendothelial migration
oor04714  Thermogenesis
oor04810  Regulation of actin cytoskeleton
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04971  Gastric acid secretion
oor05014  Amyotrophic lateral sclerosis
oor05100  Bacterial invasion of epithelial cells
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05164  Influenza A
oor05205  Proteoglycans in cancer
oor05225  Hepatocellular carcinoma
oor05410  Hypertrophic cardiomyopathy
oor05412  Arrhythmogenic right ventricular cardiomyopathy
oor05414  Dilated cardiomyopathy
oor05416  Viral myocarditis
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101271282 (ACTG1)
   04390 Hippo signaling pathway
    101271282 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101271282 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    101271282 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101271282 (ACTG1)
   04520 Adherens junction
    101271282 (ACTG1)
   04530 Tight junction
    101271282 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101271282 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101271282 (ACTG1)
   04613 Neutrophil extracellular trap formation
    101271282 (ACTG1)
   04670 Leukocyte transendothelial migration
    101271282 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101271282 (ACTG1)
   04919 Thyroid hormone signaling pathway
    101271282 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    101271282 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101271282 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101271282 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101271282 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101271282 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101271282 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    101271282 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101271282 (ACTG1)
   05414 Dilated cardiomyopathy
    101271282 (ACTG1)
   05416 Viral myocarditis
    101271282 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101271282 (ACTG1)
   05135 Yersinia infection
    101271282 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    101271282 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    101271282 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oor03021]
    101271282 (ACTG1)
   03019 Messenger RNA biogenesis [BR:oor03019]
    101271282 (ACTG1)
   03036 Chromosome and associated proteins [BR:oor03036]
    101271282 (ACTG1)
   03029 Mitochondrial biogenesis [BR:oor03029]
    101271282 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:oor04812]
    101271282 (ACTG1)
   04147 Exosome [BR:oor04147]
    101271282 (ACTG1)
Transcription machinery [BR:oor03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     101271282 (ACTG1)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101271282 (ACTG1)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     101271282 (ACTG1)
    NuA4 complex
     101271282 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    101271282 (ACTG1)
   PBAF complex
    101271282 (ACTG1)
   SWR1 complex
    101271282 (ACTG1)
Mitochondrial biogenesis [BR:oor03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    101271282 (ACTG1)
Cytoskeleton proteins [BR:oor04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     101271282 (ACTG1)
Exosome [BR:oor04147]
 Exosomal proteins
  Proteins found in most exosomes
   101271282 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 101271282
NCBI-ProteinID: XP_004275611
LinkDB
Position
Unknown
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaatcgccgcgctcgtcatcgataatggctctggcatgtgcaaagcgggc
tttgctggggatgacgctccccgggccgtgttcccgtccatcgttgggcgtccccgacac
cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc
aagcgtggcatcctgactctcaagtaccccattgagcacggcattgtcaccaattgggac
gacatggagaagatctggcaccacactttctacaacgagctgcgtgtggcccccgaggag
caccccgtgctgctgacggaggcccccctgaatcccaaggccaaccgtgagaagatgacc
cagatcatgttcgagactttcaacactccggccatgtacgtggccatccaggctgtgctg
tccctgtatgcttctggccgcaccactggtatagtcatggactctggggatggggtcacc
cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctcacggagcgtggctacagcttc
accaccacagctgagcgggaaatcgtgcgtgacatcaaggagaagctctgctacgttgcc
ctggacttcgagcaggagatggccaccgctgcgtcctcctcctccttggagaagagctac
gagctgcctgatggtcaggtgatcaccatcggcaatgagcggttccggtgtccagaggcg
ctcttccagccctctttcttgggtatggagtcctgtggcatccacgagactaccttcaac
tctatcatgaagtgtgatgtcgacatccggaaggacctgtatgccaacacggtgctgtct
ggtgggaccaccatgtatcccggcatcgccgacaggatgcagaaggagatcacggctctg
gcccccagcacaatgaagatcaagatcatcgctcctcccgagcgcaagtactcggtgtgg
atcgggggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgatgagtcaggcccctccattgtccaccgcaaatgcttctaa

KEGG   Orcinus orca (killer whale): 101277826
Entry
101277826         CDS       T05247                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04015  Rap1 signaling pathway
oor04145  Phagosome
oor04210  Apoptosis
oor04390  Hippo signaling pathway
oor04510  Focal adhesion
oor04520  Adherens junction
oor04530  Tight junction
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04670  Leukocyte transendothelial migration
oor04714  Thermogenesis
oor04810  Regulation of actin cytoskeleton
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04971  Gastric acid secretion
oor05014  Amyotrophic lateral sclerosis
oor05100  Bacterial invasion of epithelial cells
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05164  Influenza A
oor05205  Proteoglycans in cancer
oor05225  Hepatocellular carcinoma
oor05410  Hypertrophic cardiomyopathy
oor05412  Arrhythmogenic right ventricular cardiomyopathy
oor05414  Dilated cardiomyopathy
oor05416  Viral myocarditis
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101277826 (ACTB)
   04390 Hippo signaling pathway
    101277826 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101277826 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    101277826 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101277826 (ACTB)
   04520 Adherens junction
    101277826 (ACTB)
   04530 Tight junction
    101277826 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101277826 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101277826 (ACTB)
   04613 Neutrophil extracellular trap formation
    101277826 (ACTB)
   04670 Leukocyte transendothelial migration
    101277826 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101277826 (ACTB)
   04919 Thyroid hormone signaling pathway
    101277826 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    101277826 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    101277826 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101277826 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101277826 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101277826 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101277826 (ACTB)
   05410 Hypertrophic cardiomyopathy
    101277826 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101277826 (ACTB)
   05414 Dilated cardiomyopathy
    101277826 (ACTB)
   05416 Viral myocarditis
    101277826 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101277826 (ACTB)
   05135 Yersinia infection
    101277826 (ACTB)
   05100 Bacterial invasion of epithelial cells
    101277826 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    101277826 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oor03021]
    101277826 (ACTB)
   03019 Messenger RNA biogenesis [BR:oor03019]
    101277826 (ACTB)
   03036 Chromosome and associated proteins [BR:oor03036]
    101277826 (ACTB)
   03029 Mitochondrial biogenesis [BR:oor03029]
    101277826 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:oor04812]
    101277826 (ACTB)
   04147 Exosome [BR:oor04147]
    101277826 (ACTB)
Transcription machinery [BR:oor03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     101277826 (ACTB)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101277826 (ACTB)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     101277826 (ACTB)
    NuA4 complex
     101277826 (ACTB)
  Chromatin remodeling factors
   BAF complex
    101277826 (ACTB)
   PBAF complex
    101277826 (ACTB)
   SWR1 complex
    101277826 (ACTB)
Mitochondrial biogenesis [BR:oor03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    101277826 (ACTB)
Cytoskeleton proteins [BR:oor04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     101277826 (ACTB)
Exosome [BR:oor04147]
 Exosomal proteins
  Proteins found in most exosomes
   101277826 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 101277826
NCBI-ProteinID: XP_004269004
LinkDB
Position
Unknown
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggtgacgatgctccccgggccgtcttcccctccatcgtggggcgcccccggcac
cagggcgtgatggtgggcatggggcagaaggactcctatgtgggcgacgaggcgcagagc
aagagaggcatcctgaccctcaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgtgtggcccccgaggag
caccccgttctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgttcgagaccttcaacaccccagccatgtacgtggccatccaggctgtgctg
tccttgtacgcctctggacgcaccactggcatcgtgatggactccggtgatggggtcacc
cacacggtgcctatctacgaggggtacgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgacggactacctcatgaagatcctcacggagcgtggctacagcttc
accaccacggccgagcgggaaatcgtacgtgacatcaaggagaagctctgctacgtcgcc
ctggacttcgagcaggagatggccaccgcggcctccagctcctccctggagaagagctac
gagctgcccgatggtcaggtcatcaccattggcaacgagcggttccgctgccctgaggct
ctcttccagccttccttcctgggcatggaatcttgtggcatccacgaaactaccttcaat
tccatcatgaagtgtgacgtcgacatccgcaaggacctctatgccaacacggtgctgtct
ggcgggaccaccatgtacccaggcatcgctgacaggatgcagaaggagatcaccgctctg
gctcccagcacgatgaagatcaagatcatcgctccccctgaacgcaagtactccgtgtgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtctggcccctccatcgtccaccgcaagtgcttctag

DBGET integrated database retrieval system