KEGG   Orcinus orca (killer whale): 101271458Help
Entry
101271458         CDS       T05247                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00010  Glycolysis / Gluconeogenesis
oor00051  Fructose and mannose metabolism
oor00052  Galactose metabolism
oor00500  Starch and sucrose metabolism
oor00520  Amino sugar and nucleotide sugar metabolism
oor00524  Neomycin, kanamycin and gentamicin biosynthesis
oor01100  Metabolic pathways
oor01200  Carbon metabolism
oor04066  HIF-1 signaling pathway
oor04910  Insulin signaling pathway
oor04930  Type II diabetes mellitus
oor04973  Carbohydrate digestion and absorption
oor05230  Central carbon metabolism in cancer
Module
oor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101271458 (HK1)
   00051 Fructose and mannose metabolism
    101271458 (HK1)
   00052 Galactose metabolism
    101271458 (HK1)
   00500 Starch and sucrose metabolism
    101271458 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101271458 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101271458 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101271458 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101271458 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101271458 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    101271458 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101271458 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101271458 (HK1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101271458 (HK1)
Membrane trafficking [BR:oor04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101271458 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N CSD
Motif
Other DBs
NCBI-GeneID: 101271458
NCBI-ProteinID: XP_004280841
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMARFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILLVQVNHEQKQTVHMESEVYDTPESIMH
GSGSQLFGHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGTDVVKLLEKAIKKHGDYDANVVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAREILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFSLT
KDTLLEVKRRMRAEMELGLGKQTHDKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPTEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGQDVATLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVETLEGNEGQMCINMEWGAFGDNGCLDD
IRTIYDKLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEPLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRQETSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcttattacttcaccgaactgaaggatgaccaagtcaaa
aagatcgacaaatatctctatgccatgcggctctctgatgaaactctgttagatatcatg
gctcgtttcaaaaaggagatgaagaatggcctctcccgggattttaatccgacagccaca
gtcaagatgttgccaacatttgtaaggtccattcctgatggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgctggtgcaagtgaatcatgag
caaaaacagaccgttcatatggagtctgaggtttacgacaccccggagagcatcatgcac
ggcagtggaagccagctttttggtcatgtcgctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccttgtcggcaa
tccaaaatagacgaggccatcctgatcacctggacaaagagatttaaagcgagtggagtg
gagggaacggatgtggtgaagctgcttgagaaagccatcaaaaagcacggggactatgac
gccaacgttgtggctgtggtgaacgacactgtggggaccatgatgacctgtggctacgac
gaccagcagtgtgaagtcggcctcatcattggcacgggcaccaacgcgtgctacatggag
gaactgaggcacatcgacctggtggaaggcgacgaagggaggatgtgcatcaacaccgag
tggggggccttcggggacgacggggccctggaggatatccgcaccgagtttgaccgggag
attgaccgcggctcactcaaccccgggaagcagctgtttgagaagatggtcagtggcatg
tacatgggcgagctggtccgattgatcctggtcaagatggccaaggagggccttttattt
gaagggcggatcaccccggagctgctcaccagagggaagtttaacaccagtgacgtgtca
gccattgaaaagaataaggaaggcctccacaacgccagagaaatcctgacccgcctggga
gtggagccatctgatgacgactgtatttcggtccagcacgtgtgcaccattgtctcgttc
cgctctgccaacctagtggctgcgacgctgggcgccatcctgaatcgtcttcgagataac
aagagcacacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagaccctgaggcgcttggtgcccgactgcgatgtg
cgtttcctcctctcggagagtggcagcggcaagggggctgccatggtgactgcggtggcc
taccgcctggctgagcagcaccggcagatagaggagaccctggcccacttcagtctcacc
aaggatacgctgctggaggtgaaaaggaggatgcgggccgagatggaattggggctgggc
aagcagacgcatgacaaggccgtcgtcaagatgctgccctcctttgtccggagcactccc
gatgggacagagcacggtgacttcctggccctggatcttggaggaacgaatttccgcgtc
ttgctggtgaaaattcgtagtgggaaaaagagaacagtggaaatgcacaacaagatctac
gccattcccacggaaatcatgcagggcactggggaagagctgtttgaccacatcgtttct
tgcatctctgacttcctggactacatgggcatcaagggccccagaatgcctctgggcttc
acgttttcgtttccctgcaagcagacgagcttggatgcgggaatcttgatcacctggacg
aaaggttttaaggcaactgattgcgtggggcaggatgtagcgaccttactgagggatgcg
gtaaaaaggagagaggaatttgacttggacgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttatgaggagcccacctgcgaggttggactcatcgtagggacg
ggcagcaatgcctgctacatggaagaaatgaaaaacgtcgagacgctagaaggaaacgag
ggccaaatgtgtatcaacatggagtggggtgcctttggggacaacgggtgtctggatgat
atcagaacgatctatgacaaactggtggatgaatattctctaaacgctgggaagcaaagg
tatgagaagatgatcagcggtatgtacctgggtgaaatcgtccgcaacatcttgatagat
ttcaccaagaggggattcctcttccgagggcagatctctgagccgctgaagactcggggc
atctttcagaccaagtatctctctcagatcgagagcgaccgattagcgctgctgcaggtc
cgggccatcctccagcagcttggcctgaacagcacatgcgacgacagcatccttgtgaag
accgtgtgcggggtagtgtccaagagggccgcacagctgtgtggcgcaggcatggctgcc
gtggtggacaagatccgcgagaacagggggctggaccacctcaacgtgactgtgggcgtg
gacgggacgctctacaagcttcatccgcatttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcttatccgaagacggtagcggcaaggga
gccgccctcatcacggcagtgggcgttcggctccggcaagaaacgagcagctaa

DBGET integrated database retrieval system