Orcinus orca (killer whale): 101271542 Help Entry 101271542         CDS       T05247                                  Gene name RRAS2 Definition (RefSeq) ras-related protein R-Ras2 isoform X2   KO K07830   Ras-related protein R-Ras2 Organism oor  Orcinus orca (killer whale) Pathway oor04010   MAPK signaling pathway oor04014   Ras signaling pathway oor04024   cAMP signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04218   Cellular senescence oor04371   Apelin signaling pathway oor04625   C-type lectin receptor signaling pathway oor04810   Regulation of actin cytoskeleton oor05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101271542 (RRAS2)    04014 Ras signaling pathway     101271542 (RRAS2)    04371 Apelin signaling pathway     101271542 (RRAS2)    04072 Phospholipase D signaling pathway     101271542 (RRAS2)    04024 cAMP signaling pathway     101271542 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101271542 (RRAS2)    04137 Mitophagy - animal     101271542 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     101271542 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101271542 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101271542 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101271542 (RRAS2) Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101271542 (RRAS2)   Exosomal proteins of bladder cancer cells    101271542 (RRAS2) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101271542 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 RsgA_GTPase DUF2075 Motif Other DBs NCBI-GeneID:  101271542 NCBI-ProteinID:  XP_004279207 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQVFFFLQSYFVTDYDPTIEDSYTKQ CVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRV KDRDEFPMILIGNKADLDHQRQITQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRV IRKFQEQECPPSPEPTRKEKDKKGCHCVIF NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaagagaagtaccggctcgtggtggtc ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccaggtgttctttttc ttacagtcctattttgtaacggattatgatccaaccattgaggattcctacacaaagcag tgcgtgatagatgaccgggcagcccggctagatattctggatacagcgggacaagaggag tttggagctatgagagaacagtatatgagaactggcgagggtttcttgttggtcttttca gtcacagatagaggcagttttgaagaaatctataagtttcaaagacagattctcagagta aaggatcgtgatgagtttccaatgattttaattggtaataaagcagatctggatcatcag agacagataacgcaggaagaaggacagcagttagcacgacaacttaaggtaacatacatg gaggcgtcagcaaagattaggatgaatgtagatcaagctttccatgaacttgtccgggtt ataaggaaatttcaagagcaggaatgtcctccttcaccagaaccaacacggaaagaaaaa gacaagaaaggctgccactgtgtcattttctaa

Orcinus orca (killer whale): 101271947 Help Entry 101271947         CDS       T05247                                  Definition (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04012   ErbB signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04062   Chemokine signaling pathway oor04068   FoxO signaling pathway oor04071   Sphingolipid signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04144   Endocytosis oor04150   mTOR signaling pathway oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04211   Longevity regulating pathway oor04213   Longevity regulating pathway - multiple species oor04218   Cellular senescence oor04360   Axon guidance oor04370   VEGF signaling pathway oor04371   Apelin signaling pathway oor04510   Focal adhesion oor04540   Gap junction oor04550   Signaling pathways regulating pluripotency of stem cells oor04625   C-type lectin receptor signaling pathway oor04630   JAK-STAT signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04714   Thermogenesis oor04720   Long-term potentiation oor04722   Neurotrophin signaling pathway oor04725   Cholinergic synapse oor04726   Serotonergic synapse oor04730   Long-term depression oor04810   Regulation of actin cytoskeleton oor04910   Insulin signaling pathway oor04912   GnRH signaling pathway oor04915   Estrogen signaling pathway oor04916   Melanogenesis oor04917   Prolactin signaling pathway oor04919   Thyroid hormone signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04929   GnRH secretion oor04933   AGE-RAGE signaling pathway in diabetic complications oor04935   Growth hormone synthesis, secretion and action oor05010   Alzheimer disease oor05022   Pathways of neurodegeneration - multiple diseases oor05034   Alcoholism oor05132   Salmonella infection oor05160   Hepatitis C oor05161   Hepatitis B oor05163   Human cytomegalovirus infection oor05165   Human papillomavirus infection oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05205   Proteoglycans in cancer oor05206   MicroRNAs in cancer oor05210   Colorectal cancer oor05211   Renal cell carcinoma oor05213   Endometrial cancer oor05214   Glioma oor05215   Prostate cancer oor05216   Thyroid cancer oor05218   Melanoma oor05219   Bladder cancer oor05220   Chronic myeloid leukemia oor05221   Acute myeloid leukemia oor05223   Non-small cell lung cancer oor05224   Breast cancer oor05225   Hepatocellular carcinoma oor05226   Gastric cancer oor05230   Central carbon metabolism in cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101271947    04012 ErbB signaling pathway     101271947    04014 Ras signaling pathway     101271947    04015 Rap1 signaling pathway     101271947    04370 VEGF signaling pathway     101271947    04371 Apelin signaling pathway     101271947    04630 JAK-STAT signaling pathway     101271947    04068 FoxO signaling pathway     101271947    04072 Phospholipase D signaling pathway     101271947    04071 Sphingolipid signaling pathway     101271947    04151 PI3K-Akt signaling pathway     101271947    04150 mTOR signaling pathway     101271947  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101271947    04140 Autophagy - animal     101271947    04137 Mitophagy - animal     101271947   09143 Cell growth and death    04210 Apoptosis     101271947    04218 Cellular senescence     101271947   09144 Cellular community - eukaryotes    04510 Focal adhesion     101271947    04540 Gap junction     101271947    04550 Signaling pathways regulating pluripotency of stem cells     101271947   09142 Cell motility    04810 Regulation of actin cytoskeleton     101271947  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101271947    04650 Natural killer cell mediated cytotoxicity     101271947    04660 T cell receptor signaling pathway     101271947    04662 B cell receptor signaling pathway     101271947    04664 Fc epsilon RI signaling pathway     101271947    04062 Chemokine signaling pathway     101271947   09152 Endocrine system    04910 Insulin signaling pathway     101271947    04929 GnRH secretion     101271947    04912 GnRH signaling pathway     101271947    04915 Estrogen signaling pathway     101271947    04917 Prolactin signaling pathway     101271947    04921 Oxytocin signaling pathway     101271947    04926 Relaxin signaling pathway     101271947    04935 Growth hormone synthesis, secretion and action     101271947    04919 Thyroid hormone signaling pathway     101271947    04916 Melanogenesis     101271947   09156 Nervous system    04725 Cholinergic synapse     101271947    04726 Serotonergic synapse     101271947    04720 Long-term potentiation     101271947    04730 Long-term depression     101271947    04722 Neurotrophin signaling pathway     101271947   09158 Development and regeneration    04360 Axon guidance     101271947   09149 Aging    04211 Longevity regulating pathway     101271947    04213 Longevity regulating pathway - multiple species     101271947   09159 Environmental adaptation    04714 Thermogenesis     101271947  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101271947    05206 MicroRNAs in cancer     101271947    05205 Proteoglycans in cancer     101271947    05203 Viral carcinogenesis     101271947    05230 Central carbon metabolism in cancer     101271947    05231 Choline metabolism in cancer     101271947    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101271947   09162 Cancer: specific types    05210 Colorectal cancer     101271947    05225 Hepatocellular carcinoma     101271947    05226 Gastric cancer     101271947    05214 Glioma     101271947    05216 Thyroid cancer     101271947    05221 Acute myeloid leukemia     101271947    05220 Chronic myeloid leukemia     101271947    05218 Melanoma     101271947    05211 Renal cell carcinoma     101271947    05219 Bladder cancer     101271947    05215 Prostate cancer     101271947    05213 Endometrial cancer     101271947    05224 Breast cancer     101271947    05223 Non-small cell lung cancer     101271947   09164 Neurodegenerative disease    05010 Alzheimer disease     101271947    05022 Pathways of neurodegeneration - multiple diseases     101271947   09165 Substance dependence    05034 Alcoholism     101271947   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101271947   09171 Infectious disease: bacterial    05132 Salmonella infection     101271947   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101271947    05170 Human immunodeficiency virus 1 infection     101271947    05161 Hepatitis B     101271947    05160 Hepatitis C     101271947    05163 Human cytomegalovirus infection     101271947    05167 Kaposi sarcoma-associated herpesvirus infection     101271947    05165 Human papillomavirus infection     101271947   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101271947    01522 Endocrine resistance     101271947 Membrane trafficking [BR:oor04131]  Endocytosis   Macropinocytosis    Ras GTPases     101271947 Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101271947   Exosomal proteins of colorectal cancer cells    101271947 GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101271947 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc RsgA_GTPase FeoB_N AAA_14 Motif Other DBs NCBI-GeneID:  101271947 NCBI-ProteinID:  XP_012391150 LinkDB All DBs Position Unknown AA seq 220 aa AA seqDB search MTEYELTVVGARGVGKSALTIQRIQNHSVVEYFPTIEDSHRKQVVIDGEMCLLGMLDTVG REEYSAVQAQYTCTREGFLCLPSTTPSPSRARSFEDIRQYREQIEWLKESDDVPRVLLGN KCDLATCTVECWQAQDLARSYGIPYMETSAKKGQGVEDAVYKLEHKSQQHKASKLGPPAP RGWPGLPELQGLLSQLRHRRQARKRHPQGGCGEGSSGPPR NT seq 663 nt NT seq  +upstreamnt  +downstreamnt atgacggagtatgagctcacggtggtgggtgccagaggcgtggggaagagtgccctgacc atccagcgcatccagaaccactctgtggttgagtactttcccaccatagaggactcccac cggaagcaagtggtcatcgatggggagatgtgcctgctgggcatgctggacacggtgggc cgggaggagtacagcgctgtgcaggcccagtacacgtgcacccgggagggcttcctctgt ttgccgtcaacgacgccaagtccttcaagggccagatccttcgaggacatccgccagtac agagagcagattgagtggttgaaggaatcagacgacgtgcccagggtgctgttggggaac aagtgtgacctggccacgtgtaccgtggagtgttggcaggcccaggacctggcccgcagc tatggcatcccctacatggagacttcggccaagaagggccagggcgtggaggatgccgtc tacaagctggagcacaagagccagcagcacaaggcgagcaagctgggcccgcccgcccca cgggggtggcctgggctgcctgagctgcagggcctgctctcccaactgaggcacaggcga caggcaaggaagaggcacccgcagggaggatgcggggaaggaagctccggcccgcccagg tag

Orcinus orca (killer whale): 101273601 Help Entry 101273601         CDS       T05247                                  Gene name RRAS Definition (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism oor  Orcinus orca (killer whale) Pathway oor04010   MAPK signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04024   cAMP signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04218   Cellular senescence oor04360   Axon guidance oor04371   Apelin signaling pathway oor04625   C-type lectin receptor signaling pathway oor04810   Regulation of actin cytoskeleton oor05132   Salmonella infection oor05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101273601 (RRAS)    04014 Ras signaling pathway     101273601 (RRAS)    04015 Rap1 signaling pathway     101273601 (RRAS)    04371 Apelin signaling pathway     101273601 (RRAS)    04072 Phospholipase D signaling pathway     101273601 (RRAS)    04024 cAMP signaling pathway     101273601 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101273601 (RRAS)    04137 Mitophagy - animal     101273601 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     101273601 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101273601 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101273601 (RRAS)   09158 Development and regeneration    04360 Axon guidance     101273601 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101273601 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101273601 (RRAS) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101273601 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22 Motif Other DBs NCBI-GeneID:  101273601 NCBI-ProteinID:  XP_004286228 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICMVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPCPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcttacttcgtgtctgactacgacccc actattgaagactcctacacgaagatctgcatggtggatggcgtcccagcccggctagac attctggacaccgctggccaggaggagttcggtgctatgcgggaacagtacatgcgcgcc ggccatggcttcctgctggtgtttgccattaatgaccggcagagtttcaacgaggtgggc aagctcttcacgcagatcctccgagtcaaggaccgagatgacttccccatcgtgttggtc gggaacaaggcagatctggagacacagcgccaggtcccccgatccgaagcctccaccttc agcgcctcccaccacgtggcctacttcgaggcctcagccaaactgcgcctcaatgtggac gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc tgccctcccagcgcccccaggaagaaggacgggggttgcccctgcgtcctcctgtag

Orcinus orca (killer whale): 101276138 Help Entry 101276138         CDS       T05247                                  Gene name NRAS Definition (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04012   ErbB signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04062   Chemokine signaling pathway oor04068   FoxO signaling pathway oor04071   Sphingolipid signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04150   mTOR signaling pathway oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04211   Longevity regulating pathway oor04213   Longevity regulating pathway - multiple species oor04218   Cellular senescence oor04360   Axon guidance oor04370   VEGF signaling pathway oor04371   Apelin signaling pathway oor04540   Gap junction oor04550   Signaling pathways regulating pluripotency of stem cells oor04625   C-type lectin receptor signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04714   Thermogenesis oor04720   Long-term potentiation oor04722   Neurotrophin signaling pathway oor04725   Cholinergic synapse oor04726   Serotonergic synapse oor04730   Long-term depression oor04810   Regulation of actin cytoskeleton oor04910   Insulin signaling pathway oor04912   GnRH signaling pathway oor04915   Estrogen signaling pathway oor04916   Melanogenesis oor04917   Prolactin signaling pathway oor04919   Thyroid hormone signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04929   GnRH secretion oor04933   AGE-RAGE signaling pathway in diabetic complications oor04935   Growth hormone synthesis, secretion and action oor05010   Alzheimer disease oor05022   Pathways of neurodegeneration - multiple diseases oor05034   Alcoholism oor05160   Hepatitis C oor05161   Hepatitis B oor05163   Human cytomegalovirus infection oor05165   Human papillomavirus infection oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05205   Proteoglycans in cancer oor05206   MicroRNAs in cancer oor05210   Colorectal cancer oor05211   Renal cell carcinoma oor05213   Endometrial cancer oor05214   Glioma oor05215   Prostate cancer oor05216   Thyroid cancer oor05218   Melanoma oor05219   Bladder cancer oor05220   Chronic myeloid leukemia oor05221   Acute myeloid leukemia oor05223   Non-small cell lung cancer oor05224   Breast cancer oor05225   Hepatocellular carcinoma oor05226   Gastric cancer oor05230   Central carbon metabolism in cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101276138 (NRAS)    04012 ErbB signaling pathway     101276138 (NRAS)    04014 Ras signaling pathway     101276138 (NRAS)    04015 Rap1 signaling pathway     101276138 (NRAS)    04370 VEGF signaling pathway     101276138 (NRAS)    04371 Apelin signaling pathway     101276138 (NRAS)    04068 FoxO signaling pathway     101276138 (NRAS)    04072 Phospholipase D signaling pathway     101276138 (NRAS)    04071 Sphingolipid signaling pathway     101276138 (NRAS)    04151 PI3K-Akt signaling pathway     101276138 (NRAS)    04150 mTOR signaling pathway     101276138 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101276138 (NRAS)    04137 Mitophagy - animal     101276138 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101276138 (NRAS)    04218 Cellular senescence     101276138 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101276138 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101276138 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101276138 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101276138 (NRAS)    04650 Natural killer cell mediated cytotoxicity     101276138 (NRAS)    04660 T cell receptor signaling pathway     101276138 (NRAS)    04662 B cell receptor signaling pathway     101276138 (NRAS)    04664 Fc epsilon RI signaling pathway     101276138 (NRAS)    04062 Chemokine signaling pathway     101276138 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101276138 (NRAS)    04929 GnRH secretion     101276138 (NRAS)    04912 GnRH signaling pathway     101276138 (NRAS)    04915 Estrogen signaling pathway     101276138 (NRAS)    04917 Prolactin signaling pathway     101276138 (NRAS)    04921 Oxytocin signaling pathway     101276138 (NRAS)    04926 Relaxin signaling pathway     101276138 (NRAS)    04935 Growth hormone synthesis, secretion and action     101276138 (NRAS)    04919 Thyroid hormone signaling pathway     101276138 (NRAS)    04916 Melanogenesis     101276138 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     101276138 (NRAS)    04726 Serotonergic synapse     101276138 (NRAS)    04720 Long-term potentiation     101276138 (NRAS)    04730 Long-term depression     101276138 (NRAS)    04722 Neurotrophin signaling pathway     101276138 (NRAS)   09158 Development and regeneration    04360 Axon guidance     101276138 (NRAS)   09149 Aging    04211 Longevity regulating pathway     101276138 (NRAS)    04213 Longevity regulating pathway - multiple species     101276138 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     101276138 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101276138 (NRAS)    05206 MicroRNAs in cancer     101276138 (NRAS)    05205 Proteoglycans in cancer     101276138 (NRAS)    05203 Viral carcinogenesis     101276138 (NRAS)    05230 Central carbon metabolism in cancer     101276138 (NRAS)    05231 Choline metabolism in cancer     101276138 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101276138 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101276138 (NRAS)    05225 Hepatocellular carcinoma     101276138 (NRAS)    05226 Gastric cancer     101276138 (NRAS)    05214 Glioma     101276138 (NRAS)    05216 Thyroid cancer     101276138 (NRAS)    05221 Acute myeloid leukemia     101276138 (NRAS)    05220 Chronic myeloid leukemia     101276138 (NRAS)    05218 Melanoma     101276138 (NRAS)    05211 Renal cell carcinoma     101276138 (NRAS)    05219 Bladder cancer     101276138 (NRAS)    05215 Prostate cancer     101276138 (NRAS)    05213 Endometrial cancer     101276138 (NRAS)    05224 Breast cancer     101276138 (NRAS)    05223 Non-small cell lung cancer     101276138 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101276138 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     101276138 (NRAS)   09165 Substance dependence    05034 Alcoholism     101276138 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101276138 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101276138 (NRAS)    05170 Human immunodeficiency virus 1 infection     101276138 (NRAS)    05161 Hepatitis B     101276138 (NRAS)    05160 Hepatitis C     101276138 (NRAS)    05163 Human cytomegalovirus infection     101276138 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101276138 (NRAS)    05165 Human papillomavirus infection     101276138 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101276138 (NRAS)    01522 Endocrine resistance     101276138 (NRAS) Membrane trafficking [BR:oor04131]  Endocytosis   Macropinocytosis    Ras GTPases     101276138 (NRAS) Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101276138 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101276138 (NRAS)   Exosomal proteins of breast cancer cells    101276138 (NRAS)   Exosomal proteins of colorectal cancer cells    101276138 (NRAS) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101276138 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  101276138 NCBI-ProteinID:  XP_004263275 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatgggattgccatgtgtagtgatgtaa

Orcinus orca (killer whale): 101281431 Help Entry 101281431         CDS       T05247                                  Gene name MRAS Definition (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism oor  Orcinus orca (killer whale) Pathway oor04010   MAPK signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04218   Cellular senescence oor04371   Apelin signaling pathway oor04625   C-type lectin receptor signaling pathway oor04810   Regulation of actin cytoskeleton oor05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101281431 (MRAS)    04014 Ras signaling pathway     101281431 (MRAS)    04015 Rap1 signaling pathway     101281431 (MRAS)    04371 Apelin signaling pathway     101281431 (MRAS)    04072 Phospholipase D signaling pathway     101281431 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101281431 (MRAS)    04137 Mitophagy - animal     101281431 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     101281431 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101281431 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101281431 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101281431 (MRAS) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101281431 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  101281431 NCBI-ProteinID:  XP_004279008 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDRAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagtgctgtccccagtgacaacctccccacgtacaagctggtggtggtggga gacgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct gactatgaccccaccatcgaagactcctacctgaagcatacagagattgacaaccagtgg gccatcttggacgttctggacacagccggacaggaggagttcagcgccatgcgggagcag tacatgcgcacgggggacggcttcctcatcgtcttctcggtcacggacaaggccagcttc gagcacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcattcccg atgatcctcgtggccaacaaggtcgatttgatgcatttgaggaaaatcaccagggagcaa ggaaaagaaatggccaccaaacacaatattccgtacatagaaaccagtgccaaggaccca cctctcaacgtcgacagagccttccatgacctggttagagtaattaggcaacagattcca gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccactggcacc cacaaactgcagtgcgtgatattgtga

Orcinus orca (killer whale): 101281897 Help Entry 101281897         CDS       T05247                                  Gene name KRAS Definition (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04012   ErbB signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04062   Chemokine signaling pathway oor04068   FoxO signaling pathway oor04071   Sphingolipid signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04150   mTOR signaling pathway oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04211   Longevity regulating pathway oor04213   Longevity regulating pathway - multiple species oor04218   Cellular senescence oor04360   Axon guidance oor04370   VEGF signaling pathway oor04371   Apelin signaling pathway oor04540   Gap junction oor04550   Signaling pathways regulating pluripotency of stem cells oor04625   C-type lectin receptor signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04714   Thermogenesis oor04720   Long-term potentiation oor04722   Neurotrophin signaling pathway oor04725   Cholinergic synapse oor04726   Serotonergic synapse oor04730   Long-term depression oor04810   Regulation of actin cytoskeleton oor04910   Insulin signaling pathway oor04912   GnRH signaling pathway oor04914   Progesterone-mediated oocyte maturation oor04915   Estrogen signaling pathway oor04916   Melanogenesis oor04917   Prolactin signaling pathway oor04919   Thyroid hormone signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04929   GnRH secretion oor04933   AGE-RAGE signaling pathway in diabetic complications oor04935   Growth hormone synthesis, secretion and action oor04960   Aldosterone-regulated sodium reabsorption oor05010   Alzheimer disease oor05022   Pathways of neurodegeneration - multiple diseases oor05034   Alcoholism oor05160   Hepatitis C oor05161   Hepatitis B oor05163   Human cytomegalovirus infection oor05165   Human papillomavirus infection oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05205   Proteoglycans in cancer oor05206   MicroRNAs in cancer oor05210   Colorectal cancer oor05211   Renal cell carcinoma oor05212   Pancreatic cancer oor05213   Endometrial cancer oor05214   Glioma oor05215   Prostate cancer oor05216   Thyroid cancer oor05218   Melanoma oor05219   Bladder cancer oor05220   Chronic myeloid leukemia oor05221   Acute myeloid leukemia oor05223   Non-small cell lung cancer oor05224   Breast cancer oor05225   Hepatocellular carcinoma oor05226   Gastric cancer oor05230   Central carbon metabolism in cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101281897 (KRAS)    04012 ErbB signaling pathway     101281897 (KRAS)    04014 Ras signaling pathway     101281897 (KRAS)    04015 Rap1 signaling pathway     101281897 (KRAS)    04370 VEGF signaling pathway     101281897 (KRAS)    04371 Apelin signaling pathway     101281897 (KRAS)    04068 FoxO signaling pathway     101281897 (KRAS)    04072 Phospholipase D signaling pathway     101281897 (KRAS)    04071 Sphingolipid signaling pathway     101281897 (KRAS)    04151 PI3K-Akt signaling pathway     101281897 (KRAS)    04150 mTOR signaling pathway     101281897 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101281897 (KRAS)    04137 Mitophagy - animal     101281897 (KRAS)   09143 Cell growth and death    04210 Apoptosis     101281897 (KRAS)    04218 Cellular senescence     101281897 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101281897 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101281897 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101281897 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101281897 (KRAS)    04650 Natural killer cell mediated cytotoxicity     101281897 (KRAS)    04660 T cell receptor signaling pathway     101281897 (KRAS)    04662 B cell receptor signaling pathway     101281897 (KRAS)    04664 Fc epsilon RI signaling pathway     101281897 (KRAS)    04062 Chemokine signaling pathway     101281897 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101281897 (KRAS)    04929 GnRH secretion     101281897 (KRAS)    04912 GnRH signaling pathway     101281897 (KRAS)    04915 Estrogen signaling pathway     101281897 (KRAS)    04914 Progesterone-mediated oocyte maturation     101281897 (KRAS)    04917 Prolactin signaling pathway     101281897 (KRAS)    04921 Oxytocin signaling pathway     101281897 (KRAS)    04926 Relaxin signaling pathway     101281897 (KRAS)    04935 Growth hormone synthesis, secretion and action     101281897 (KRAS)    04919 Thyroid hormone signaling pathway     101281897 (KRAS)    04916 Melanogenesis     101281897 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     101281897 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     101281897 (KRAS)    04726 Serotonergic synapse     101281897 (KRAS)    04720 Long-term potentiation     101281897 (KRAS)    04730 Long-term depression     101281897 (KRAS)    04722 Neurotrophin signaling pathway     101281897 (KRAS)   09158 Development and regeneration    04360 Axon guidance     101281897 (KRAS)   09149 Aging    04211 Longevity regulating pathway     101281897 (KRAS)    04213 Longevity regulating pathway - multiple species     101281897 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     101281897 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101281897 (KRAS)    05206 MicroRNAs in cancer     101281897 (KRAS)    05205 Proteoglycans in cancer     101281897 (KRAS)    05203 Viral carcinogenesis     101281897 (KRAS)    05230 Central carbon metabolism in cancer     101281897 (KRAS)    05231 Choline metabolism in cancer     101281897 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101281897 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101281897 (KRAS)    05212 Pancreatic cancer     101281897 (KRAS)    05225 Hepatocellular carcinoma     101281897 (KRAS)    05226 Gastric cancer     101281897 (KRAS)    05214 Glioma     101281897 (KRAS)    05216 Thyroid cancer     101281897 (KRAS)    05221 Acute myeloid leukemia     101281897 (KRAS)    05220 Chronic myeloid leukemia     101281897 (KRAS)    05218 Melanoma     101281897 (KRAS)    05211 Renal cell carcinoma     101281897 (KRAS)    05219 Bladder cancer     101281897 (KRAS)    05215 Prostate cancer     101281897 (KRAS)    05213 Endometrial cancer     101281897 (KRAS)    05224 Breast cancer     101281897 (KRAS)    05223 Non-small cell lung cancer     101281897 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101281897 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     101281897 (KRAS)   09165 Substance dependence    05034 Alcoholism     101281897 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101281897 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101281897 (KRAS)    05170 Human immunodeficiency virus 1 infection     101281897 (KRAS)    05161 Hepatitis B     101281897 (KRAS)    05160 Hepatitis C     101281897 (KRAS)    05163 Human cytomegalovirus infection     101281897 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101281897 (KRAS)    05165 Human papillomavirus infection     101281897 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101281897 (KRAS)    01522 Endocrine resistance     101281897 (KRAS) Membrane trafficking [BR:oor04131]  Endocytosis   Macropinocytosis    Ras GTPases     101281897 (KRAS) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101281897 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 NPR1_interact G-alpha FeoB_N ATP_bind_1 Motif Other DBs NCBI-GeneID:  101281897 NCBI-ProteinID:  XP_004270955 LinkDB All DBs Position Unknown AA seq 227 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIVMGVDDAFYTLVREIRKHKEKMSKEGKKKKKKSKTKCIIM NT seq 684 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac agaaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct tttattgaaacatctgcaaagacaagacagagagtggaggatgctttttatacattggtg agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattgtaatgggcgttgacgatgccttctatacattagttcga gaaattcgaaaacataaagaaaagatgagcaaagaaggtaaaaagaagaaaaagaagtca aagacaaagtgtataattatgtaa

Orcinus orca (killer whale): 101286301 Help Entry 101286301         CDS       T05247                                  Gene name HRAS Definition (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01522   Endocrine resistance oor04010   MAPK signaling pathway oor04012   ErbB signaling pathway oor04014   Ras signaling pathway oor04015   Rap1 signaling pathway oor04062   Chemokine signaling pathway oor04068   FoxO signaling pathway oor04071   Sphingolipid signaling pathway oor04072   Phospholipase D signaling pathway oor04137   Mitophagy - animal oor04140   Autophagy - animal oor04144   Endocytosis oor04150   mTOR signaling pathway oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04211   Longevity regulating pathway oor04213   Longevity regulating pathway - multiple species oor04218   Cellular senescence oor04360   Axon guidance oor04370   VEGF signaling pathway oor04371   Apelin signaling pathway oor04510   Focal adhesion oor04540   Gap junction oor04550   Signaling pathways regulating pluripotency of stem cells oor04625   C-type lectin receptor signaling pathway oor04630   JAK-STAT signaling pathway oor04650   Natural killer cell mediated cytotoxicity oor04660   T cell receptor signaling pathway oor04662   B cell receptor signaling pathway oor04664   Fc epsilon RI signaling pathway oor04714   Thermogenesis oor04720   Long-term potentiation oor04722   Neurotrophin signaling pathway oor04725   Cholinergic synapse oor04726   Serotonergic synapse oor04730   Long-term depression oor04810   Regulation of actin cytoskeleton oor04910   Insulin signaling pathway oor04912   GnRH signaling pathway oor04915   Estrogen signaling pathway oor04916   Melanogenesis oor04917   Prolactin signaling pathway oor04919   Thyroid hormone signaling pathway oor04921   Oxytocin signaling pathway oor04926   Relaxin signaling pathway oor04929   GnRH secretion oor04933   AGE-RAGE signaling pathway in diabetic complications oor04935   Growth hormone synthesis, secretion and action oor05010   Alzheimer disease oor05022   Pathways of neurodegeneration - multiple diseases oor05034   Alcoholism oor05132   Salmonella infection oor05160   Hepatitis C oor05161   Hepatitis B oor05163   Human cytomegalovirus infection oor05165   Human papillomavirus infection oor05166   Human T-cell leukemia virus 1 infection oor05167   Kaposi sarcoma-associated herpesvirus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05203   Viral carcinogenesis oor05205   Proteoglycans in cancer oor05206   MicroRNAs in cancer oor05210   Colorectal cancer oor05211   Renal cell carcinoma oor05213   Endometrial cancer oor05214   Glioma oor05215   Prostate cancer oor05216   Thyroid cancer oor05218   Melanoma oor05219   Bladder cancer oor05220   Chronic myeloid leukemia oor05221   Acute myeloid leukemia oor05223   Non-small cell lung cancer oor05224   Breast cancer oor05225   Hepatocellular carcinoma oor05226   Gastric cancer oor05230   Central carbon metabolism in cancer oor05231   Choline metabolism in cancer oor05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:oor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101286301 (HRAS)    04012 ErbB signaling pathway     101286301 (HRAS)    04014 Ras signaling pathway     101286301 (HRAS)    04015 Rap1 signaling pathway     101286301 (HRAS)    04370 VEGF signaling pathway     101286301 (HRAS)    04371 Apelin signaling pathway     101286301 (HRAS)    04630 JAK-STAT signaling pathway     101286301 (HRAS)    04068 FoxO signaling pathway     101286301 (HRAS)    04072 Phospholipase D signaling pathway     101286301 (HRAS)    04071 Sphingolipid signaling pathway     101286301 (HRAS)    04151 PI3K-Akt signaling pathway     101286301 (HRAS)    04150 mTOR signaling pathway     101286301 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101286301 (HRAS)    04140 Autophagy - animal     101286301 (HRAS)    04137 Mitophagy - animal     101286301 (HRAS)   09143 Cell growth and death    04210 Apoptosis     101286301 (HRAS)    04218 Cellular senescence     101286301 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101286301 (HRAS)    04540 Gap junction     101286301 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101286301 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101286301 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101286301 (HRAS)    04650 Natural killer cell mediated cytotoxicity     101286301 (HRAS)    04660 T cell receptor signaling pathway     101286301 (HRAS)    04662 B cell receptor signaling pathway     101286301 (HRAS)    04664 Fc epsilon RI signaling pathway     101286301 (HRAS)    04062 Chemokine signaling pathway     101286301 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101286301 (HRAS)    04929 GnRH secretion     101286301 (HRAS)    04912 GnRH signaling pathway     101286301 (HRAS)    04915 Estrogen signaling pathway     101286301 (HRAS)    04917 Prolactin signaling pathway     101286301 (HRAS)    04921 Oxytocin signaling pathway     101286301 (HRAS)    04926 Relaxin signaling pathway     101286301 (HRAS)    04935 Growth hormone synthesis, secretion and action     101286301 (HRAS)    04919 Thyroid hormone signaling pathway     101286301 (HRAS)    04916 Melanogenesis     101286301 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     101286301 (HRAS)    04726 Serotonergic synapse     101286301 (HRAS)    04720 Long-term potentiation     101286301 (HRAS)    04730 Long-term depression     101286301 (HRAS)    04722 Neurotrophin signaling pathway     101286301 (HRAS)   09158 Development and regeneration    04360 Axon guidance     101286301 (HRAS)   09149 Aging    04211 Longevity regulating pathway     101286301 (HRAS)    04213 Longevity regulating pathway - multiple species     101286301 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     101286301 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101286301 (HRAS)    05206 MicroRNAs in cancer     101286301 (HRAS)    05205 Proteoglycans in cancer     101286301 (HRAS)    05203 Viral carcinogenesis     101286301 (HRAS)    05230 Central carbon metabolism in cancer     101286301 (HRAS)    05231 Choline metabolism in cancer     101286301 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101286301 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101286301 (HRAS)    05225 Hepatocellular carcinoma     101286301 (HRAS)    05226 Gastric cancer     101286301 (HRAS)    05214 Glioma     101286301 (HRAS)    05216 Thyroid cancer     101286301 (HRAS)    05221 Acute myeloid leukemia     101286301 (HRAS)    05220 Chronic myeloid leukemia     101286301 (HRAS)    05218 Melanoma     101286301 (HRAS)    05211 Renal cell carcinoma     101286301 (HRAS)    05219 Bladder cancer     101286301 (HRAS)    05215 Prostate cancer     101286301 (HRAS)    05213 Endometrial cancer     101286301 (HRAS)    05224 Breast cancer     101286301 (HRAS)    05223 Non-small cell lung cancer     101286301 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101286301 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     101286301 (HRAS)   09165 Substance dependence    05034 Alcoholism     101286301 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101286301 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     101286301 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101286301 (HRAS)    05170 Human immunodeficiency virus 1 infection     101286301 (HRAS)    05161 Hepatitis B     101286301 (HRAS)    05160 Hepatitis C     101286301 (HRAS)    05163 Human cytomegalovirus infection     101286301 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101286301 (HRAS)    05165 Human papillomavirus infection     101286301 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101286301 (HRAS)    01522 Endocrine resistance     101286301 (HRAS) Membrane trafficking [BR:oor04131]  Endocytosis   Macropinocytosis    Ras GTPases     101286301 (HRAS) Exosome [BR:oor04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101286301 (HRAS)   Exosomal proteins of colorectal cancer cells    101286301 (HRAS) GTP-binding proteins [BR:oor04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101286301 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA AAA_22 Septin ATP_bind_1 Ldh_1_N AAA_25 AAA_16 Motif Other DBs NCBI-GeneID:  101286301 NCBI-ProteinID:  XP_004278151 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKVRKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagcgccctgacc atccagctcattcagaaccactttgtggatgagtacgaccccaccatagaggactcctac cggaagcaagtggtcatcgatggggagacgtgcctgttggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt gtgtttgccatcaacaacgccaagtccttcgaggacatccaccagtatagggagcagatc aaacgggtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg cgcgagatccggcagcacaaggtgcgcaagctgagcccgcctgacgagggtggcccgggc tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system