KEGG   Orcinus orca (killer whale): 101271542
Entry
101271542         CDS       T05247                                 

Gene name
RRAS2
Definition
(RefSeq) ras-related protein R-Ras2 isoform X2
  KO
K07830  Ras-related protein R-Ras2
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04024  cAMP signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04218  Cellular senescence
oor04371  Apelin signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04810  Regulation of actin cytoskeleton
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101271542 (RRAS2)
   04014 Ras signaling pathway
    101271542 (RRAS2)
   04371 Apelin signaling pathway
    101271542 (RRAS2)
   04072 Phospholipase D signaling pathway
    101271542 (RRAS2)
   04024 cAMP signaling pathway
    101271542 (RRAS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101271542 (RRAS2)
   04137 Mitophagy - animal
    101271542 (RRAS2)
  09143 Cell growth and death
   04218 Cellular senescence
    101271542 (RRAS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101271542 (RRAS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101271542 (RRAS2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101271542 (RRAS2)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101271542 (RRAS2)
  Exosomal proteins of bladder cancer cells
   101271542 (RRAS2)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101271542 (RRAS2)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 RsgA_GTPase DUF2075
Other DBs
NCBI-GeneID: 101271542
NCBI-ProteinID: XP_004279207
LinkDB
Position
Unknown
AA seq 210 aa
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQVFFFLQSYFVTDYDPTIEDSYTKQ
CVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRV
KDRDEFPMILIGNKADLDHQRQITQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRV
IRKFQEQECPPSPEPTRKEKDKKGCHCVIF
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccgcggccggctggcgggacggctccggccaagagaagtaccggctcgtggtggtc
ggcgggggcggcgtgggcaagtcggcgctcaccatccagttcatccaggtgttctttttc
ttacagtcctattttgtaacggattatgatccaaccattgaggattcctacacaaagcag
tgcgtgatagatgaccgggcagcccggctagatattctggatacagcgggacaagaggag
tttggagctatgagagaacagtatatgagaactggcgagggtttcttgttggtcttttca
gtcacagatagaggcagttttgaagaaatctataagtttcaaagacagattctcagagta
aaggatcgtgatgagtttccaatgattttaattggtaataaagcagatctggatcatcag
agacagataacgcaggaagaaggacagcagttagcacgacaacttaaggtaacatacatg
gaggcgtcagcaaagattaggatgaatgtagatcaagctttccatgaacttgtccgggtt
ataaggaaatttcaagagcaggaatgtcctccttcaccagaaccaacacggaaagaaaaa
gacaagaaaggctgccactgtgtcattttctaa

KEGG   Orcinus orca (killer whale): 101271947
Entry
101271947         CDS       T05247                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04144  Endocytosis
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05132  Salmonella infection
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101271947
   04012 ErbB signaling pathway
    101271947
   04014 Ras signaling pathway
    101271947
   04015 Rap1 signaling pathway
    101271947
   04370 VEGF signaling pathway
    101271947
   04371 Apelin signaling pathway
    101271947
   04630 JAK-STAT signaling pathway
    101271947
   04068 FoxO signaling pathway
    101271947
   04072 Phospholipase D signaling pathway
    101271947
   04071 Sphingolipid signaling pathway
    101271947
   04151 PI3K-Akt signaling pathway
    101271947
   04150 mTOR signaling pathway
    101271947
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101271947
   04140 Autophagy - animal
    101271947
   04137 Mitophagy - animal
    101271947
  09143 Cell growth and death
   04210 Apoptosis
    101271947
   04218 Cellular senescence
    101271947
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101271947
   04540 Gap junction
    101271947
   04550 Signaling pathways regulating pluripotency of stem cells
    101271947
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101271947
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101271947
   04650 Natural killer cell mediated cytotoxicity
    101271947
   04660 T cell receptor signaling pathway
    101271947
   04662 B cell receptor signaling pathway
    101271947
   04664 Fc epsilon RI signaling pathway
    101271947
   04062 Chemokine signaling pathway
    101271947
  09152 Endocrine system
   04910 Insulin signaling pathway
    101271947
   04929 GnRH secretion
    101271947
   04912 GnRH signaling pathway
    101271947
   04915 Estrogen signaling pathway
    101271947
   04917 Prolactin signaling pathway
    101271947
   04921 Oxytocin signaling pathway
    101271947
   04926 Relaxin signaling pathway
    101271947
   04935 Growth hormone synthesis, secretion and action
    101271947
   04919 Thyroid hormone signaling pathway
    101271947
   04916 Melanogenesis
    101271947
  09156 Nervous system
   04725 Cholinergic synapse
    101271947
   04726 Serotonergic synapse
    101271947
   04720 Long-term potentiation
    101271947
   04730 Long-term depression
    101271947
   04722 Neurotrophin signaling pathway
    101271947
  09158 Development and regeneration
   04360 Axon guidance
    101271947
  09149 Aging
   04211 Longevity regulating pathway
    101271947
   04213 Longevity regulating pathway - multiple species
    101271947
  09159 Environmental adaptation
   04714 Thermogenesis
    101271947
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101271947
   05206 MicroRNAs in cancer
    101271947
   05205 Proteoglycans in cancer
    101271947
   05203 Viral carcinogenesis
    101271947
   05230 Central carbon metabolism in cancer
    101271947
   05231 Choline metabolism in cancer
    101271947
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101271947
  09162 Cancer: specific types
   05210 Colorectal cancer
    101271947
   05225 Hepatocellular carcinoma
    101271947
   05226 Gastric cancer
    101271947
   05214 Glioma
    101271947
   05216 Thyroid cancer
    101271947
   05221 Acute myeloid leukemia
    101271947
   05220 Chronic myeloid leukemia
    101271947
   05218 Melanoma
    101271947
   05211 Renal cell carcinoma
    101271947
   05219 Bladder cancer
    101271947
   05215 Prostate cancer
    101271947
   05213 Endometrial cancer
    101271947
   05224 Breast cancer
    101271947
   05223 Non-small cell lung cancer
    101271947
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101271947
   05022 Pathways of neurodegeneration - multiple diseases
    101271947
  09165 Substance dependence
   05034 Alcoholism
    101271947
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101271947
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101271947
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101271947
   05170 Human immunodeficiency virus 1 infection
    101271947
   05161 Hepatitis B
    101271947
   05160 Hepatitis C
    101271947
   05163 Human cytomegalovirus infection
    101271947
   05167 Kaposi sarcoma-associated herpesvirus infection
    101271947
   05165 Human papillomavirus infection
    101271947
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101271947
   01522 Endocrine resistance
    101271947
Membrane trafficking [BR:oor04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101271947
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101271947
  Exosomal proteins of colorectal cancer cells
   101271947
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101271947
SSDB
Motif
Pfam: Ras Roc RsgA_GTPase FeoB_N AAA_14
Other DBs
NCBI-GeneID: 101271947
NCBI-ProteinID: XP_012391150
LinkDB
Position
Unknown
AA seq 220 aa
MTEYELTVVGARGVGKSALTIQRIQNHSVVEYFPTIEDSHRKQVVIDGEMCLLGMLDTVG
REEYSAVQAQYTCTREGFLCLPSTTPSPSRARSFEDIRQYREQIEWLKESDDVPRVLLGN
KCDLATCTVECWQAQDLARSYGIPYMETSAKKGQGVEDAVYKLEHKSQQHKASKLGPPAP
RGWPGLPELQGLLSQLRHRRQARKRHPQGGCGEGSSGPPR
NT seq 663 nt   +upstreamnt  +downstreamnt
atgacggagtatgagctcacggtggtgggtgccagaggcgtggggaagagtgccctgacc
atccagcgcatccagaaccactctgtggttgagtactttcccaccatagaggactcccac
cggaagcaagtggtcatcgatggggagatgtgcctgctgggcatgctggacacggtgggc
cgggaggagtacagcgctgtgcaggcccagtacacgtgcacccgggagggcttcctctgt
ttgccgtcaacgacgccaagtccttcaagggccagatccttcgaggacatccgccagtac
agagagcagattgagtggttgaaggaatcagacgacgtgcccagggtgctgttggggaac
aagtgtgacctggccacgtgtaccgtggagtgttggcaggcccaggacctggcccgcagc
tatggcatcccctacatggagacttcggccaagaagggccagggcgtggaggatgccgtc
tacaagctggagcacaagagccagcagcacaaggcgagcaagctgggcccgcccgcccca
cgggggtggcctgggctgcctgagctgcagggcctgctctcccaactgaggcacaggcga
caggcaaggaagaggcacccgcagggaggatgcggggaaggaagctccggcccgcccagg
tag

KEGG   Orcinus orca (killer whale): 101273601
Entry
101273601         CDS       T05247                                 

Gene name
RRAS
Definition
(RefSeq) ras-related protein R-Ras
  KO
K07829  Ras-related protein R-Ras
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04218  Cellular senescence
oor04360  Axon guidance
oor04371  Apelin signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04810  Regulation of actin cytoskeleton
oor05132  Salmonella infection
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101273601 (RRAS)
   04014 Ras signaling pathway
    101273601 (RRAS)
   04015 Rap1 signaling pathway
    101273601 (RRAS)
   04371 Apelin signaling pathway
    101273601 (RRAS)
   04072 Phospholipase D signaling pathway
    101273601 (RRAS)
   04024 cAMP signaling pathway
    101273601 (RRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101273601 (RRAS)
   04137 Mitophagy - animal
    101273601 (RRAS)
  09143 Cell growth and death
   04218 Cellular senescence
    101273601 (RRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101273601 (RRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101273601 (RRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101273601 (RRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101273601 (RRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101273601 (RRAS)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101273601 (RRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22
Other DBs
NCBI-GeneID: 101273601
NCBI-ProteinID: XP_004286228
LinkDB
Position
Unknown
AA seq 218 aa
MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICMVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPPCPPSAPRKKDGGCPCVLL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg
cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg
ggcaagagcgcgctgaccatccagttcatccagtcttacttcgtgtctgactacgacccc
actattgaagactcctacacgaagatctgcatggtggatggcgtcccagcccggctagac
attctggacaccgctggccaggaggagttcggtgctatgcgggaacagtacatgcgcgcc
ggccatggcttcctgctggtgtttgccattaatgaccggcagagtttcaacgaggtgggc
aagctcttcacgcagatcctccgagtcaaggaccgagatgacttccccatcgtgttggtc
gggaacaaggcagatctggagacacagcgccaggtcccccgatccgaagcctccaccttc
agcgcctcccaccacgtggcctacttcgaggcctcagccaaactgcgcctcaatgtggac
gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc
tgccctcccagcgcccccaggaagaaggacgggggttgcccctgcgtcctcctgtag

KEGG   Orcinus orca (killer whale): 101276138
Entry
101276138         CDS       T05247                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04625  C-type lectin receptor signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101276138 (NRAS)
   04012 ErbB signaling pathway
    101276138 (NRAS)
   04014 Ras signaling pathway
    101276138 (NRAS)
   04015 Rap1 signaling pathway
    101276138 (NRAS)
   04370 VEGF signaling pathway
    101276138 (NRAS)
   04371 Apelin signaling pathway
    101276138 (NRAS)
   04068 FoxO signaling pathway
    101276138 (NRAS)
   04072 Phospholipase D signaling pathway
    101276138 (NRAS)
   04071 Sphingolipid signaling pathway
    101276138 (NRAS)
   04151 PI3K-Akt signaling pathway
    101276138 (NRAS)
   04150 mTOR signaling pathway
    101276138 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101276138 (NRAS)
   04137 Mitophagy - animal
    101276138 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101276138 (NRAS)
   04218 Cellular senescence
    101276138 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101276138 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101276138 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101276138 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101276138 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    101276138 (NRAS)
   04660 T cell receptor signaling pathway
    101276138 (NRAS)
   04662 B cell receptor signaling pathway
    101276138 (NRAS)
   04664 Fc epsilon RI signaling pathway
    101276138 (NRAS)
   04062 Chemokine signaling pathway
    101276138 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101276138 (NRAS)
   04929 GnRH secretion
    101276138 (NRAS)
   04912 GnRH signaling pathway
    101276138 (NRAS)
   04915 Estrogen signaling pathway
    101276138 (NRAS)
   04917 Prolactin signaling pathway
    101276138 (NRAS)
   04921 Oxytocin signaling pathway
    101276138 (NRAS)
   04926 Relaxin signaling pathway
    101276138 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    101276138 (NRAS)
   04919 Thyroid hormone signaling pathway
    101276138 (NRAS)
   04916 Melanogenesis
    101276138 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101276138 (NRAS)
   04726 Serotonergic synapse
    101276138 (NRAS)
   04720 Long-term potentiation
    101276138 (NRAS)
   04730 Long-term depression
    101276138 (NRAS)
   04722 Neurotrophin signaling pathway
    101276138 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101276138 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101276138 (NRAS)
   04213 Longevity regulating pathway - multiple species
    101276138 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101276138 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101276138 (NRAS)
   05206 MicroRNAs in cancer
    101276138 (NRAS)
   05205 Proteoglycans in cancer
    101276138 (NRAS)
   05203 Viral carcinogenesis
    101276138 (NRAS)
   05230 Central carbon metabolism in cancer
    101276138 (NRAS)
   05231 Choline metabolism in cancer
    101276138 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101276138 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101276138 (NRAS)
   05225 Hepatocellular carcinoma
    101276138 (NRAS)
   05226 Gastric cancer
    101276138 (NRAS)
   05214 Glioma
    101276138 (NRAS)
   05216 Thyroid cancer
    101276138 (NRAS)
   05221 Acute myeloid leukemia
    101276138 (NRAS)
   05220 Chronic myeloid leukemia
    101276138 (NRAS)
   05218 Melanoma
    101276138 (NRAS)
   05211 Renal cell carcinoma
    101276138 (NRAS)
   05219 Bladder cancer
    101276138 (NRAS)
   05215 Prostate cancer
    101276138 (NRAS)
   05213 Endometrial cancer
    101276138 (NRAS)
   05224 Breast cancer
    101276138 (NRAS)
   05223 Non-small cell lung cancer
    101276138 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101276138 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101276138 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    101276138 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101276138 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101276138 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    101276138 (NRAS)
   05161 Hepatitis B
    101276138 (NRAS)
   05160 Hepatitis C
    101276138 (NRAS)
   05163 Human cytomegalovirus infection
    101276138 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101276138 (NRAS)
   05165 Human papillomavirus infection
    101276138 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101276138 (NRAS)
   01522 Endocrine resistance
    101276138 (NRAS)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101276138 (NRAS)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101276138 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   101276138 (NRAS)
  Exosomal proteins of breast cancer cells
   101276138 (NRAS)
  Exosomal proteins of colorectal cancer cells
   101276138 (NRAS)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101276138 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 101276138
NCBI-ProteinID: XP_004263275
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtagtgatgtaa

KEGG   Orcinus orca (killer whale): 101281431
Entry
101281431         CDS       T05247                                 

Gene name
MRAS
Definition
(RefSeq) ras-related protein M-Ras
  KO
K07831  Ras-related protein M-Ras
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04218  Cellular senescence
oor04371  Apelin signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04810  Regulation of actin cytoskeleton
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101281431 (MRAS)
   04014 Ras signaling pathway
    101281431 (MRAS)
   04015 Rap1 signaling pathway
    101281431 (MRAS)
   04371 Apelin signaling pathway
    101281431 (MRAS)
   04072 Phospholipase D signaling pathway
    101281431 (MRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101281431 (MRAS)
   04137 Mitophagy - animal
    101281431 (MRAS)
  09143 Cell growth and death
   04218 Cellular senescence
    101281431 (MRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101281431 (MRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101281431 (MRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101281431 (MRAS)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101281431 (MRAS)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 101281431
NCBI-ProteinID: XP_004279008
LinkDB
Position
Unknown
AA seq 208 aa
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDRAFHDLVRVIRQQIP
EKSQKKKKKTKWRGDRATGTHKLQCVIL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcgaccagtgctgtccccagtgacaacctccccacgtacaagctggtggtggtggga
gacgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct
gactatgaccccaccatcgaagactcctacctgaagcatacagagattgacaaccagtgg
gccatcttggacgttctggacacagccggacaggaggagttcagcgccatgcgggagcag
tacatgcgcacgggggacggcttcctcatcgtcttctcggtcacggacaaggccagcttc
gagcacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcattcccg
atgatcctcgtggccaacaaggtcgatttgatgcatttgaggaaaatcaccagggagcaa
ggaaaagaaatggccaccaaacacaatattccgtacatagaaaccagtgccaaggaccca
cctctcaacgtcgacagagccttccatgacctggttagagtaattaggcaacagattcca
gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccactggcacc
cacaaactgcagtgcgtgatattgtga

KEGG   Orcinus orca (killer whale): 101281897
Entry
101281897         CDS       T05247                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04625  C-type lectin receptor signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101281897 (KRAS)
   04012 ErbB signaling pathway
    101281897 (KRAS)
   04014 Ras signaling pathway
    101281897 (KRAS)
   04015 Rap1 signaling pathway
    101281897 (KRAS)
   04370 VEGF signaling pathway
    101281897 (KRAS)
   04371 Apelin signaling pathway
    101281897 (KRAS)
   04068 FoxO signaling pathway
    101281897 (KRAS)
   04072 Phospholipase D signaling pathway
    101281897 (KRAS)
   04071 Sphingolipid signaling pathway
    101281897 (KRAS)
   04151 PI3K-Akt signaling pathway
    101281897 (KRAS)
   04150 mTOR signaling pathway
    101281897 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101281897 (KRAS)
   04137 Mitophagy - animal
    101281897 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101281897 (KRAS)
   04218 Cellular senescence
    101281897 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101281897 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101281897 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101281897 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101281897 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    101281897 (KRAS)
   04660 T cell receptor signaling pathway
    101281897 (KRAS)
   04662 B cell receptor signaling pathway
    101281897 (KRAS)
   04664 Fc epsilon RI signaling pathway
    101281897 (KRAS)
   04062 Chemokine signaling pathway
    101281897 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101281897 (KRAS)
   04929 GnRH secretion
    101281897 (KRAS)
   04912 GnRH signaling pathway
    101281897 (KRAS)
   04915 Estrogen signaling pathway
    101281897 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    101281897 (KRAS)
   04917 Prolactin signaling pathway
    101281897 (KRAS)
   04921 Oxytocin signaling pathway
    101281897 (KRAS)
   04926 Relaxin signaling pathway
    101281897 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    101281897 (KRAS)
   04919 Thyroid hormone signaling pathway
    101281897 (KRAS)
   04916 Melanogenesis
    101281897 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101281897 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101281897 (KRAS)
   04726 Serotonergic synapse
    101281897 (KRAS)
   04720 Long-term potentiation
    101281897 (KRAS)
   04730 Long-term depression
    101281897 (KRAS)
   04722 Neurotrophin signaling pathway
    101281897 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101281897 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101281897 (KRAS)
   04213 Longevity regulating pathway - multiple species
    101281897 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101281897 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101281897 (KRAS)
   05206 MicroRNAs in cancer
    101281897 (KRAS)
   05205 Proteoglycans in cancer
    101281897 (KRAS)
   05203 Viral carcinogenesis
    101281897 (KRAS)
   05230 Central carbon metabolism in cancer
    101281897 (KRAS)
   05231 Choline metabolism in cancer
    101281897 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101281897 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101281897 (KRAS)
   05212 Pancreatic cancer
    101281897 (KRAS)
   05225 Hepatocellular carcinoma
    101281897 (KRAS)
   05226 Gastric cancer
    101281897 (KRAS)
   05214 Glioma
    101281897 (KRAS)
   05216 Thyroid cancer
    101281897 (KRAS)
   05221 Acute myeloid leukemia
    101281897 (KRAS)
   05220 Chronic myeloid leukemia
    101281897 (KRAS)
   05218 Melanoma
    101281897 (KRAS)
   05211 Renal cell carcinoma
    101281897 (KRAS)
   05219 Bladder cancer
    101281897 (KRAS)
   05215 Prostate cancer
    101281897 (KRAS)
   05213 Endometrial cancer
    101281897 (KRAS)
   05224 Breast cancer
    101281897 (KRAS)
   05223 Non-small cell lung cancer
    101281897 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101281897 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101281897 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    101281897 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101281897 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101281897 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    101281897 (KRAS)
   05161 Hepatitis B
    101281897 (KRAS)
   05160 Hepatitis C
    101281897 (KRAS)
   05163 Human cytomegalovirus infection
    101281897 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101281897 (KRAS)
   05165 Human papillomavirus infection
    101281897 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101281897 (KRAS)
   01522 Endocrine resistance
    101281897 (KRAS)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101281897 (KRAS)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101281897 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 NPR1_interact G-alpha FeoB_N ATP_bind_1
Other DBs
NCBI-GeneID: 101281897
NCBI-ProteinID: XP_004270955
LinkDB
Position
Unknown
AA seq 227 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVMGVDDAFYTLVREIRKHKEKMSKEGKKKKKKSKTKCIIM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
agaaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatctgcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgggcgttgacgatgccttctatacattagttcga
gaaattcgaaaacataaagaaaagatgagcaaagaaggtaaaaagaagaaaaagaagtca
aagacaaagtgtataattatgtaa

KEGG   Orcinus orca (killer whale): 101286301
Entry
101286301         CDS       T05247                                 

Gene name
HRAS
Definition
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04144  Endocytosis
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05132  Salmonella infection
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101286301 (HRAS)
   04012 ErbB signaling pathway
    101286301 (HRAS)
   04014 Ras signaling pathway
    101286301 (HRAS)
   04015 Rap1 signaling pathway
    101286301 (HRAS)
   04370 VEGF signaling pathway
    101286301 (HRAS)
   04371 Apelin signaling pathway
    101286301 (HRAS)
   04630 JAK-STAT signaling pathway
    101286301 (HRAS)
   04068 FoxO signaling pathway
    101286301 (HRAS)
   04072 Phospholipase D signaling pathway
    101286301 (HRAS)
   04071 Sphingolipid signaling pathway
    101286301 (HRAS)
   04151 PI3K-Akt signaling pathway
    101286301 (HRAS)
   04150 mTOR signaling pathway
    101286301 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101286301 (HRAS)
   04140 Autophagy - animal
    101286301 (HRAS)
   04137 Mitophagy - animal
    101286301 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101286301 (HRAS)
   04218 Cellular senescence
    101286301 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101286301 (HRAS)
   04540 Gap junction
    101286301 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101286301 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101286301 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101286301 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    101286301 (HRAS)
   04660 T cell receptor signaling pathway
    101286301 (HRAS)
   04662 B cell receptor signaling pathway
    101286301 (HRAS)
   04664 Fc epsilon RI signaling pathway
    101286301 (HRAS)
   04062 Chemokine signaling pathway
    101286301 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101286301 (HRAS)
   04929 GnRH secretion
    101286301 (HRAS)
   04912 GnRH signaling pathway
    101286301 (HRAS)
   04915 Estrogen signaling pathway
    101286301 (HRAS)
   04917 Prolactin signaling pathway
    101286301 (HRAS)
   04921 Oxytocin signaling pathway
    101286301 (HRAS)
   04926 Relaxin signaling pathway
    101286301 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    101286301 (HRAS)
   04919 Thyroid hormone signaling pathway
    101286301 (HRAS)
   04916 Melanogenesis
    101286301 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101286301 (HRAS)
   04726 Serotonergic synapse
    101286301 (HRAS)
   04720 Long-term potentiation
    101286301 (HRAS)
   04730 Long-term depression
    101286301 (HRAS)
   04722 Neurotrophin signaling pathway
    101286301 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101286301 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101286301 (HRAS)
   04213 Longevity regulating pathway - multiple species
    101286301 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101286301 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101286301 (HRAS)
   05206 MicroRNAs in cancer
    101286301 (HRAS)
   05205 Proteoglycans in cancer
    101286301 (HRAS)
   05203 Viral carcinogenesis
    101286301 (HRAS)
   05230 Central carbon metabolism in cancer
    101286301 (HRAS)
   05231 Choline metabolism in cancer
    101286301 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101286301 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101286301 (HRAS)
   05225 Hepatocellular carcinoma
    101286301 (HRAS)
   05226 Gastric cancer
    101286301 (HRAS)
   05214 Glioma
    101286301 (HRAS)
   05216 Thyroid cancer
    101286301 (HRAS)
   05221 Acute myeloid leukemia
    101286301 (HRAS)
   05220 Chronic myeloid leukemia
    101286301 (HRAS)
   05218 Melanoma
    101286301 (HRAS)
   05211 Renal cell carcinoma
    101286301 (HRAS)
   05219 Bladder cancer
    101286301 (HRAS)
   05215 Prostate cancer
    101286301 (HRAS)
   05213 Endometrial cancer
    101286301 (HRAS)
   05224 Breast cancer
    101286301 (HRAS)
   05223 Non-small cell lung cancer
    101286301 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101286301 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101286301 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    101286301 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101286301 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101286301 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101286301 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    101286301 (HRAS)
   05161 Hepatitis B
    101286301 (HRAS)
   05160 Hepatitis C
    101286301 (HRAS)
   05163 Human cytomegalovirus infection
    101286301 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101286301 (HRAS)
   05165 Human papillomavirus infection
    101286301 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101286301 (HRAS)
   01522 Endocrine resistance
    101286301 (HRAS)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101286301 (HRAS)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101286301 (HRAS)
  Exosomal proteins of colorectal cancer cells
   101286301 (HRAS)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101286301 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA AAA_22 Septin ATP_bind_1 Ldh_1_N AAA_25 AAA_16
Other DBs
NCBI-GeneID: 101286301
NCBI-ProteinID: XP_004278151
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKVRKLSPPDEGGPG
CLSCRCLLS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagcgccctgacc
atccagctcattcagaaccactttgtggatgagtacgaccccaccatagaggactcctac
cggaagcaagtggtcatcgatggggagacgtgcctgttggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt
gtgtttgccatcaacaacgccaagtccttcgaggacatccaccagtatagggagcagatc
aaacgggtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc
tacatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg
cgcgagatccggcagcacaaggtgcgcaagctgagcccgcctgacgagggtggcccgggc
tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system