KEGG   Orcinus orca (killer whale): 101271628Help
Entry
101271628         CDS       T05247                                 

Gene name
CHRNA10
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-10
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101271628 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oor04040]
    101271628 (CHRNA10)
Ion channels [BR:oor04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   101271628 (CHRNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 101271628
NCBI-ProteinID: XP_004279893
LinkDB All DBs
Position
Unknown
AA seq 457 aa AA seqDB search
MGPGSHRLSLSISVSSLGLLLLLPLLPECFGAEGRLAHKLFRDLFANYTSALRPVADTDQ
ALNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPDAYGGLDAIRIPSSLVWR
PDIILYNKADAQAPASASTNVVLRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFG
SWTHGGHQLDVQTRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLR
RRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAE
SVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSARPVPAWARTLLLGRLARGLCVRER
GEPCGQSRPPESSPSPQPPDREAGPPAGPCHEPRCLCHQEALLRHVATITNTFHRHRAAQ
RCHEEWKRLARVMDRFFLGIFFSMALVMSLLVLVQAL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggggcccggcagccaccgcctcagcctcagcatctctgtctccagtctgggccttctg
cttctgctcccactcctgccagagtgcttcggagctgagggcaggctggcacacaagctg
ttccgagacctctttgccaactacacaagtgccctgagacctgtggcagacacagaccag
gctctgaacgtgaccctggaagtgacgttgtcccagatcatcgacatggatgagcggaac
caggtgctgaccctgtacctgtggatccgacaggagtggacagatgcctacctacgatgg
gaccctgacgcctatggtggcctggatgccatccgcatccccagcagtctcgtgtggcga
ccggacatcatactctataacaaggcggatgcgcaggcgccagcctcagccagcaccaac
gtggtcctgcggcacgacggcgccgtgcgctgggacgcgccggccatcacgcgcagctcg
tgccgcgtcgacgtgtcggccttcccattcgacgcgcagcgctgcggcctgacgttcggc
tcgtggacgcacggcgggcaccagctggacgtacagacgcgcggcgccgccgccagcctg
gccgacttcgtggagaacgtggagtggcgtgtgctgggcatgccggcccggcggcgcgtg
ctcacctacggctgctgctccgagccctacccggacgtgaccttcacgctgctgctgcgc
cgccgcgccgccgcctacgtgtgcaacctgctgctgccctgcgtgctcatctcgctgctg
gcgcctctcgccttccacctgcccgccgactcgggcgagaaggtgtcgctcggcgtcacc
gtgctgctggcgctcacggtcttccagctgctcctggccgagagcatgccgccggccgag
agcgtgccgctcatcggaaagtactacatggccaccatgaccatggttaccttctccaca
gcgctcaccatccttatcatgaacttgcattactgtggtcccagtgcccgcccagtgcca
gcctgggctcggaccctcctgctgggacgcctggcgcggggcctgtgtgtgcgggaacga
ggggagccctgtgggcagtctagacctcctgagtcatcccccagcccccagcctcctgac
agagaagctggcccaccagcaggcccttgccatgagcctcggtgtctgtgccatcaggaa
gccctgctgcgccatgtagccaccatcaccaacaccttccacagacacagggctgcccag
cgctgccatgaggagtggaagcgcctggcccgtgtcatggaccgtttcttcctgggcatc
ttcttctccatggctctggtgatgagccttctcgtgctggtgcaggccctgtga

DBGET integrated database retrieval system