KEGG   Orcinus orca (killer whale): 101271799Help
Entry
101271799         CDS       T05247                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00350  Tyrosine metabolism
oor01100  Metabolic pathways
Module
oor_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101271799 (GSTZ1)
Enzymes [BR:oor01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101271799 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101271799
NCBI-ProteinID: XP_004262327
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MAESRKPILYSYFRSSCSWRVRIALALKNMDYETITINLTKDGGQQFSEEFQALNPMKQV
PALKIDGITIGQSLAIIEYLEETRPTPRLLPQDPKKRAHVRMISHLVASGIQPLQNLSVL
KQVGPENQLTWAQQAISSGFNALEQILQSTAGKYCVGDEVSMADLCLAPQVANADRFKVD
LTPYPTISRINKSLLALEAFQVSHPCRQPDTPPELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtctaggaagcccatcctctattcctacttccgaagctcctgctcatggaga
gttcgaatcgctctggccttgaaaaacatggactatgagacgataaccatcaacctcaca
aaggatggggggcagcagttctctgaagaattccaggccctgaatcccatgaagcaggtg
ccagccctgaagattgatggaatcaccattggccagtcactggccatcattgagtacctg
gaggagacccggcccacgccgcgactcctgcctcaggacccaaagaagagggcccacgtg
cgcatgatttcccacctcgtggccagcggcatccagcccctgcagaacctgtctgtcctg
aagcaagtgggaccggagaaccagctgacctgggcccagcaggccatcagttctggcttt
aacgctctggagcagatcctgcagagcacagcggggaagtactgtgtgggagatgaggtg
tccatggctgatctgtgcttagcgcctcaggtggcaaatgctgacaggttcaaggtggat
ctcactccctaccctaccatcagccgtatcaacaagtcactgctggccttggaggccttc
caagtgtctcacccctgccggcagccagatacaccccctgagctgagggcctag

DBGET integrated database retrieval system