KEGG   Orcinus orca (killer whale): 101271923Help
Entry
101271923         CDS       T05247                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03030  DNA replication
oor03410  Base excision repair
oor03420  Nucleotide excision repair
oor03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101271923 (LIG1)
   03410 Base excision repair
    101271923 (LIG1)
   03420 Nucleotide excision repair
    101271923 (LIG1)
   03430 Mismatch repair
    101271923 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oor03032]
    101271923 (LIG1)
   03400 DNA repair and recombination proteins [BR:oor03400]
    101271923 (LIG1)
Enzymes [BR:oor01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101271923 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101271923 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101271923 (LIG1)
DNA replication proteins [BR:oor03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101271923 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101271923 (LIG1)
DNA repair and recombination proteins [BR:oor03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101271923 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101271923 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     101271923 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 101271923
NCBI-ProteinID: XP_012388930
LinkDB All DBs
Position
Unknown
AA seq 922 aa AA seqDB search
MQRSIMSFFQPKKEGKVKKPEKEISNSTRETESPPKVALKERNRVVPEGDSPVKRPGRKM
ARVLGSEGEDEEEEAPKPPKIQKCAPDSPQVSPPSPGTLPESSPSHSSTSPTVVSPSGIP
KRRTARKQLSKRTFQDVLQEQGKDEDGGTKKKRKKEEEEEEELETPTESLTEPEGGNKKE
AEEGDQPRSPPEPLKTSTKPPTESVSEPKVAVKQGPQEDGQAKPPPKAPKTLSSFFSPRK
PAIKQEAKEEGPSALRKDETKGHLDPSSYNPAKNNYHPVEDACWKVGQRVPYLAVARTFE
KIEEVSARLRMVETLSNLLRSVAALTPADLLPVLYLSLNRLGPPQQGLELGIGDGILLKA
VAQATGRQLESVRAEAAEKGDVGLVAESSRSTQRLMLPPPALTASGVFTKFRDIAQLAGS
ASTAKKMDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFP
PAVVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGVERLPEHCRLSPG
VPLKPMLAHPTRGVSEVLRRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGR
YPDIISRIHKIKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCL
YAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKD
SCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGG
FLLAAYDEESEELQAICKLGTGFSDEELEEHHQTLQALVLPAPRSYVRADGAVAPDHWLD
PSAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFICVREDKKPEEATTSAQVACLY
RKQSQIQNQQGTEPDSDLEDFY
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtattatgtcatttttccagcccaagaaagagggcaaagtgaagaagcca
gagaaggagatatccaacagcaccagagaaacagagtcccctccaaaggtggcgctgaag
gagcggaatagagtggtacctgagggcgactctccagtgaagaggccagggaggaagatg
gcccgggtcctgggcagtgaaggggaggacgaggaggaggaagcccccaagccccccaaa
atccagaagtgtgctccagattccccacaagtctcccctcccagtcctggcacactgcct
gagagcagcccttcccactctagcacctctcccacggtcgtctccccgtcagggatcccg
aagcgtcgcacggcccggaagcagctttccaaacggacatttcaggatgtcctgcaagag
cagggcaaggacgaggacggaggaaccaagaagaagaggaagaaggaggaggaggaggaa
gaagaattagagacaccgacagaaagcctcacagagcctgaagggggcaacaagaaggaa
gcagaagaaggggaccagcccaggtcaccccctgagcccctgaagacctccacaaagccc
ccaacagaaagcgtttcagagcccaaggtggccgtgaagcagggaccacaggaggacggc
caggctaagcctccccccaaagctcccaagacgctcagcagtttcttctctccccggaag
ccagcgatcaaacaagaagcaaaagaagagggacccagcgctctgagaaaggacgagacc
aagggacacctggacccatccagctacaatcctgccaagaacaactaccatcccgtcgaa
gatgcttgctggaaggtgggccagagagtcccttacctggctgtggcccggacgtttgag
aagatcgaagaggtttctgcacggctccggatggtggagacactgagcaacctcctgcgc
tccgtggcggccctgacacctgctgacctcctccccgtcctctacctcagcctcaaccgc
ctggggccgccccagcagggcctggagctcggcattggcgacggcatcctcctcaaggcg
gtggcccaggccacaggccggcagctcgagtcggtccgggccgaggcggccgagaagggc
gacgtggggctggtggccgagagcagccgcagcacccagaggctcatgctgcccccaccc
gccctcaccgcctccggcgtcttcaccaagttccgggacatcgcgcagctggccggcagc
gcttccacagccaagaagatggatgtcatcaaaggcctctttgtggcctgccgccactca
gaagcacgattcatcgccagagccctgagtggacggctgcgcctcgggctggcagagcag
tcagtgctggcggccctcgcccaggccgtgagcctcaccccgccaggtcaagaattcccc
ccagccgtggtggatgctgggaagggcaagacagcagaggccagaaagacatggctggag
gagcaaggcatgatcctgaagcagacgttctgcgaggtgcccgacctggaccggatcgtc
cccgtgttgctggagcacggtgtggagcggctcccggagcactgcaggctgagcccaggg
gtccccctgaaaccaatgttggcccacccaacgcggggcgtcagcgaggtcctgaggcgc
tttgaggaggcagctttcacctgcgagtacaaatatgatgggcagagggcacagatccac
gttttggaaggcggggaggtgaagatcttcagcaggaatcaggaggacaataccggaagg
taccctgatatcatcagccgcatccacaagattaaactcccatcagtcacatccttcatc
ctggacgcggaagctgtggcttgggaccgggaaaagaagcagatccagccattccaagtg
ctcaccacccgcaaacgcaaggaggtggacgcggcagagatccaggtgcaggtgtgtctg
tacgccttcgacctcatctacctcaatggagagtccctggtacgtgagcccctttcccga
cgccggcagctgctccgggagaacttcgtggagacggagggcgagtttgtctttgccacc
tctctggacaccaaggacacggaccagatcgccgagttcttggagcagtcggtgaaagac
tcctgcgaggggctgatggtgaagaccctggatgtggacgccacctacgagatcgccaag
aggtcgcacaactggctcaagctgaagaaggactacctggatggcgtgggcgacaccctg
gacctcgtggtgatcggcgcctacctgggccggggaaagcgggccggccggtacgggggc
ttcctgctggccgcctacgacgaggagagcgaggaactgcaggccatatgcaagctcgga
acgggcttcagcgacgaggagctagaggagcatcaccagaccctccaggccctggtgctg
cccgccccacgctcctatgtccgggccgacggcgccgtggcccctgaccactggctggac
cccagcgccgtgtgggaggtgaagtgcgcagacctctccctctcccccatctacccggct
gcccggggcctggtggatagcgagaagggaatctccctccgcttccctcggtttatctgc
gtccgtgaggacaagaagccggaggaggccaccaccagtgcccaggtggcctgtctgtac
cggaagcaaagtcagattcagaaccagcaaggcacagagccagactccgacctggaagat
ttctactag

DBGET integrated database retrieval system