KEGG   Orcinus orca (killer whale): 101271966
Entry
101271966         CDS       T05247                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04068  FoxO signaling pathway
oor04270  Vascular smooth muscle contraction
oor04650  Natural killer cell mediated cytotoxicity
oor04720  Long-term potentiation
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04928  Parathyroid hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101271966 (ARAF)
   04012 ErbB signaling pathway
    101271966 (ARAF)
   04068 FoxO signaling pathway
    101271966 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101271966 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101271966 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101271966 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    101271966 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101271966 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101271966 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101271966 (ARAF)
   04720 Long-term potentiation
    101271966 (ARAF)
   04730 Long-term depression
    101271966 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101271966 (ARAF)
   05205 Proteoglycans in cancer
    101271966 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101271966 (ARAF)
   05212 Pancreatic cancer
    101271966 (ARAF)
   05225 Hepatocellular carcinoma
    101271966 (ARAF)
   05226 Gastric cancer
    101271966 (ARAF)
   05214 Glioma
    101271966 (ARAF)
   05221 Acute myeloid leukemia
    101271966 (ARAF)
   05220 Chronic myeloid leukemia
    101271966 (ARAF)
   05218 Melanoma
    101271966 (ARAF)
   05211 Renal cell carcinoma
    101271966 (ARAF)
   05219 Bladder cancer
    101271966 (ARAF)
   05215 Prostate cancer
    101271966 (ARAF)
   05213 Endometrial cancer
    101271966 (ARAF)
   05224 Breast cancer
    101271966 (ARAF)
   05223 Non-small cell lung cancer
    101271966 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101271966 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    101271966 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    101271966 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101271966 (ARAF)
   05160 Hepatitis C
    101271966 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101271966 (ARAF)
   01522 Endocrine resistance
    101271966 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101271966 (ARAF)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101271966 (ARAF)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101271966 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 101271966
NCBI-ProteinID: XP_012392955
LinkDB
Position
Unknown
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSSCTQHRDPKHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSGLIQLPAQSFN
TDAAGNRGGGDGTPRGSPSPASMSSGRKSPHSKSPSEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaacggggccgagccatcccgggcggtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtttacgactcattagacaaggccctcaaggtgcggggactcaatcaggattgctgtgtg
gtctaccggctcatcaagggtcgaaagacagtcaccgcctgggacacagccattgcaccc
ctggatggcgaggagctcattgtggaggtcctcgaagacgtccccctgaccatgcacaat
tttgtacggaagacgttcttcagcctggccttttgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggatacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcatgaggctccctcgaaccgccccctgaatgagccactc
acccctcagggtcccagctcctgcacccagcaccgtgaccccaagcacttccccttccct
gccccggccaacgcccccctccagcgcatccgctccacatccacccccaacgtccacatg
gtcagcaccacggcccccatggactctggcctcatccagctccctgcccagagtttcaac
actgacgctgccgggaatagaggtggtggtgatggaaccccccgggggagccccagccca
gccagcatgtcctcggggaggaagtccccacattccaagtccccgtcagagcagcgggag
cggaagtccttggccgatgacaagaagaaagtgaagaatctggggtaccgggactcgggc
tattactgggaggtgccacccagtgaggtgcagctgctgaagaggatcgggacgggctcg
tttgggaccgtgtttcgtgggcggtggcacggcgatgtggccgtgaaggtgctcaaggtg
gcccaacccacagctgagcaggcccaggccttcaagaacgagatgcaggtgctcaggaag
acacgtcacgtcaacatcttgctgttcatgggcttcatgacccggccgggatttgctatc
atcacacagtggtgcgagggctccagtctctaccaccacctgcacgtggccgacacacgc
tttgacatggtccagctcattgatgtggcccggcagactgcccagggcatggactacctc
catgccaagaacatcatccaccgagatctcaagtctaacaacatcttcctacacgagggg
ctcacggtgaagatcggggacttcggcctggccacagtgaagacgcggtggagtggggcc
cagcctttggagcagccctcgggctctgtgctatggatggcagctgaggtgatccgtatg
caggacccgaacccctacagcttccagtcggatgtctacgcctatggggttgtgctctac
gagctcatgaccggctcgctgccttacagccacattggcagccgtgaccagattatcttt
atggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgccccaag
gccatgaggcgcctgctgtctgactgcctcaagttccagcgggaggagcggcccctcttc
ccccagatcctggccacgattgagctgctgcagcggtcactccccaagattgagcggagt
gcctccgaaccctccttgcaccgtacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgccttgtgccttag

KEGG   Orcinus orca (killer whale): 101272984
Entry
101272984         CDS       T05247                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04218  Cellular senescence
oor04270  Vascular smooth muscle contraction
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04929  GnRH secretion
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05132  Salmonella infection
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101272984 (RAF1)
   04012 ErbB signaling pathway
    101272984 (RAF1)
   04014 Ras signaling pathway
    101272984 (RAF1)
   04015 Rap1 signaling pathway
    101272984 (RAF1)
   04370 VEGF signaling pathway
    101272984 (RAF1)
   04371 Apelin signaling pathway
    101272984 (RAF1)
   04630 JAK-STAT signaling pathway
    101272984 (RAF1)
   04068 FoxO signaling pathway
    101272984 (RAF1)
   04072 Phospholipase D signaling pathway
    101272984 (RAF1)
   04071 Sphingolipid signaling pathway
    101272984 (RAF1)
   04024 cAMP signaling pathway
    101272984 (RAF1)
   04022 cGMP-PKG signaling pathway
    101272984 (RAF1)
   04151 PI3K-Akt signaling pathway
    101272984 (RAF1)
   04150 mTOR signaling pathway
    101272984 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101272984 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    101272984 (RAF1)
   04218 Cellular senescence
    101272984 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101272984 (RAF1)
   04540 Gap junction
    101272984 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101272984 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101272984 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101272984 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    101272984 (RAF1)
   04660 T cell receptor signaling pathway
    101272984 (RAF1)
   04662 B cell receptor signaling pathway
    101272984 (RAF1)
   04664 Fc epsilon RI signaling pathway
    101272984 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    101272984 (RAF1)
   04062 Chemokine signaling pathway
    101272984 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101272984 (RAF1)
   04929 GnRH secretion
    101272984 (RAF1)
   04912 GnRH signaling pathway
    101272984 (RAF1)
   04915 Estrogen signaling pathway
    101272984 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    101272984 (RAF1)
   04917 Prolactin signaling pathway
    101272984 (RAF1)
   04921 Oxytocin signaling pathway
    101272984 (RAF1)
   04926 Relaxin signaling pathway
    101272984 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    101272984 (RAF1)
   04919 Thyroid hormone signaling pathway
    101272984 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    101272984 (RAF1)
   04916 Melanogenesis
    101272984 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101272984 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    101272984 (RAF1)
   04720 Long-term potentiation
    101272984 (RAF1)
   04730 Long-term depression
    101272984 (RAF1)
   04722 Neurotrophin signaling pathway
    101272984 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    101272984 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101272984 (RAF1)
   05206 MicroRNAs in cancer
    101272984 (RAF1)
   05205 Proteoglycans in cancer
    101272984 (RAF1)
   05230 Central carbon metabolism in cancer
    101272984 (RAF1)
   05231 Choline metabolism in cancer
    101272984 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101272984 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101272984 (RAF1)
   05212 Pancreatic cancer
    101272984 (RAF1)
   05225 Hepatocellular carcinoma
    101272984 (RAF1)
   05226 Gastric cancer
    101272984 (RAF1)
   05214 Glioma
    101272984 (RAF1)
   05221 Acute myeloid leukemia
    101272984 (RAF1)
   05220 Chronic myeloid leukemia
    101272984 (RAF1)
   05218 Melanoma
    101272984 (RAF1)
   05211 Renal cell carcinoma
    101272984 (RAF1)
   05219 Bladder cancer
    101272984 (RAF1)
   05215 Prostate cancer
    101272984 (RAF1)
   05213 Endometrial cancer
    101272984 (RAF1)
   05224 Breast cancer
    101272984 (RAF1)
   05223 Non-small cell lung cancer
    101272984 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101272984 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101272984 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    101272984 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101272984 (RAF1)
   05152 Tuberculosis
    101272984 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101272984 (RAF1)
   05161 Hepatitis B
    101272984 (RAF1)
   05160 Hepatitis C
    101272984 (RAF1)
   05164 Influenza A
    101272984 (RAF1)
   05163 Human cytomegalovirus infection
    101272984 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101272984 (RAF1)
   05165 Human papillomavirus infection
    101272984 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101272984 (RAF1)
   01522 Endocrine resistance
    101272984 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101272984 (RAF1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101272984 (RAF1)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101272984 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 101272984
NCBI-ProteinID: XP_004284344
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPVLPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHGESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHISNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagatgct
gtgtttgatggccccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaacttacggacccttctaagacaagcaacactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagttttcaga
cttctccacgaacacaagggtaaaaaagcacgtttagattggaatactgatgctgcctcc
ttgattggagaggaacttcaagtagatttcctggatcatgttccactcacaacacacaac
tttgctcggaagaccttcctgaaacttgccttctgtgacatctgtcagaagttcctgcta
aatgggtttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttgctgttcccaaattccact
gttggtgatagtggggtcccagtactgccttctttgacaatgcgtcggatgcgagagtct
gtctcccggatgcctgttagttcccagcacagatactccacaccccacgctttcacattc
aacacctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccttgcccgtggacagcaggatgattgaggatgca
attcgaagtcacggtgaatcagcctcaccttcagccttgtccagcagtcccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcaccg
ggatccagcacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
gggactgtttataagggcaagtggcatggagatgttgcagtaaagattctaaaggttgtt
gaccccacaccagagcagttccaggccttcaggaatgaagtggctgtccttcgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctataaacacctgcacgtccaggagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactacttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtcaaaattggagactttggtttggcaacagtgaagtcgcgctggagtggttctcag
caggttgaacaacccaccggctccatcttgtggatggccccagaggtgattcgaatgcag
gacaataacccgttcagcttccagtccgacgtctactcttacggcatcgtgctgtacgag
cttatgacgggggagctgccctactcccacatcagcaaccgcgatcagatcatcttcatg
gtaggccgagggtacgcctccccagaccttagtaagctgtacaagaactgccccaaagca
atgaagaggctggtagccgactgtgtgaagaaagttaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccataccgaggacatcaatgcctgcacgctgacc
acatcccctagattgcctgtcttctag

KEGG   Orcinus orca (killer whale): 101277195
Entry
101277195         CDS       T05247                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04150  mTOR signaling pathway
oor04270  Vascular smooth muscle contraction
oor04510  Focal adhesion
oor04650  Natural killer cell mediated cytotoxicity
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101277195 (BRAF)
   04012 ErbB signaling pathway
    101277195 (BRAF)
   04015 Rap1 signaling pathway
    101277195 (BRAF)
   04068 FoxO signaling pathway
    101277195 (BRAF)
   04024 cAMP signaling pathway
    101277195 (BRAF)
   04150 mTOR signaling pathway
    101277195 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101277195 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101277195 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101277195 (BRAF)
   04062 Chemokine signaling pathway
    101277195 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101277195 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    101277195 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    101277195 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101277195 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    101277195 (BRAF)
   04720 Long-term potentiation
    101277195 (BRAF)
   04730 Long-term depression
    101277195 (BRAF)
   04722 Neurotrophin signaling pathway
    101277195 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101277195 (BRAF)
   05205 Proteoglycans in cancer
    101277195 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101277195 (BRAF)
   05212 Pancreatic cancer
    101277195 (BRAF)
   05225 Hepatocellular carcinoma
    101277195 (BRAF)
   05226 Gastric cancer
    101277195 (BRAF)
   05214 Glioma
    101277195 (BRAF)
   05216 Thyroid cancer
    101277195 (BRAF)
   05221 Acute myeloid leukemia
    101277195 (BRAF)
   05220 Chronic myeloid leukemia
    101277195 (BRAF)
   05218 Melanoma
    101277195 (BRAF)
   05211 Renal cell carcinoma
    101277195 (BRAF)
   05219 Bladder cancer
    101277195 (BRAF)
   05215 Prostate cancer
    101277195 (BRAF)
   05213 Endometrial cancer
    101277195 (BRAF)
   05224 Breast cancer
    101277195 (BRAF)
   05223 Non-small cell lung cancer
    101277195 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101277195 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    101277195 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    101277195 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101277195 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101277195 (BRAF)
   05160 Hepatitis C
    101277195 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101277195 (BRAF)
   01522 Endocrine resistance
    101277195 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101277195 (BRAF)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101277195 (BRAF)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101277195 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 101277195
NCBI-ProteinID: XP_004272180
LinkDB
Position
Unknown
AA seq 762 aa
MAALSGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLD
KFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSS
SLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALM
MRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLA
FCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEAS
LAETTLTSGSSPSAPPSDSIGPPILTSPSPSKSIPIPQPFRPDEDHRNQFGQRDRSSSAP
NVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERK
SSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNV
TAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETK
FEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGS
HQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIF
MVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRS
ASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVHLTN
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcgcggagcagggccaggctctgttcaacggggac
atggagcccgaggccggcgccgcggcctcttcggctgcggacccggccattcccgaggag
gtgtggaatatcaaacaaatgattaaattgacacaggagcatatagaggccctactggac
aaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaatacacc
agcaagctagatgccctccaacaaagagaacaacagttattggaatccctggggaatgga
actgatttttctgtttctagctctgcatcaacagacaccgttacatcttcttcctcttct
agcctttcagtgctgccttcatctctttcagtttttcaaaatcccacagatgtgtcacgg
agcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaataaacagagg
acggtggtacctgcaaggtgtggagttacagtccgggacagcctaaagaaagcactgatg
atgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggagagaagaaa
ccaattggctgggacactgatatttcctggcttactggagaggaattgcatgtagaagtg
ttggagaatgttccacttacaacacacaactttgtacggaaaacttttttcaccttagca
ttttgtgacttctgtcgaaagctgcttttccaggggttccgctgtcaaacatgtggttat
aaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaactt
gatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaggaggcctcc
ttagcagagactacccttacgtctggatcatccccttctgcacccccctccgattctatt
gggcccccaattctcaccagtccgtctccttcaaaatccattccaattccacagcctttc
cgaccagatgaagatcatcgaaatcagtttggacaacgagaccggtcctcatcagctcca
aatgtgcatataaacaccatagaacctgtcaatattgatgacttgattagagaccaaggg
tttcgtagtgatggaggatcaaccacaggtttatctgccacgccccctgcctcattacct
ggctcactcactaatgtgaaagcattacagaaatctccaggacctcagcgagaaaggaag
tcatcttcatcctcagaagacaggaatcgaatgaaaacacttggtagacgggattcaagt
gacgattgggagattcctgatgggcagatcacagtgggacaaagaattggatccgggtca
tttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttgaatgtg
acagcacccacacctcagcagttacaggccttcaaaaatgaagtaggagtactcaggaaa
actcgacatgtgaatatcctactcttcatgggttattcaacaaagccacaactggctatt
gttacccagtggtgtgagggctccagcctatatcatcatctccacatcattgagaccaaa
ttcgagatgatcaaacttatagatattgcacggcagactgcacagggcatggattactta
cacgccaagtcaatcatccacagagacctcaagagtaataatatttttcttcatgaagac
ctcacagtaaaaataggtgattttggtctagccacagtgaaatctcgatggagtgggtcc
catcaatttgaacagttgtctggatccattttgtggatggcaccagaagtaatcagaatg
caagataaaaacccatatagctttcagtcagatgtatatgcatttgggattgttctgtat
gaattgatgaccggacagttaccttattcaaacatcaacaacagggaccagataattttt
atggtgggacgaggatatctatctccagatctcagtaaggtacggagtaactgtccaaaa
gccatgaagagattaatggcagagtgcctaaaaaagaaaagagatgagagaccactcttt
ccccaaattctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagt
gcatccgaaccctctttgaatcgggctggcttccaaacagaggattttagtctgtatgct
tgtgcttctccaaaaacacccatccaagcagggggatatggtgcgtttcctgtccattta
acaaactaa

DBGET integrated database retrieval system