KEGG   Orcinus orca (killer whale): 101272095
Entry
101272095         CDS       T05247                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04728  Dopaminergic synapse
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04920  Adipocytokine signaling pathway
oor04922  Glucagon signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101272095 (AKT2)
   04012 ErbB signaling pathway
    101272095 (AKT2)
   04014 Ras signaling pathway
    101272095 (AKT2)
   04015 Rap1 signaling pathway
    101272095 (AKT2)
   04370 VEGF signaling pathway
    101272095 (AKT2)
   04371 Apelin signaling pathway
    101272095 (AKT2)
   04630 JAK-STAT signaling pathway
    101272095 (AKT2)
   04668 TNF signaling pathway
    101272095 (AKT2)
   04066 HIF-1 signaling pathway
    101272095 (AKT2)
   04068 FoxO signaling pathway
    101272095 (AKT2)
   04072 Phospholipase D signaling pathway
    101272095 (AKT2)
   04071 Sphingolipid signaling pathway
    101272095 (AKT2)
   04024 cAMP signaling pathway
    101272095 (AKT2)
   04022 cGMP-PKG signaling pathway
    101272095 (AKT2)
   04151 PI3K-Akt signaling pathway
    101272095 (AKT2)
   04152 AMPK signaling pathway
    101272095 (AKT2)
   04150 mTOR signaling pathway
    101272095 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101272095 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    101272095 (AKT2)
   04218 Cellular senescence
    101272095 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101272095 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101272095 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101272095 (AKT2)
   04613 Neutrophil extracellular trap formation
    101272095 (AKT2)
   04620 Toll-like receptor signaling pathway
    101272095 (AKT2)
   04625 C-type lectin receptor signaling pathway
    101272095 (AKT2)
   04660 T cell receptor signaling pathway
    101272095 (AKT2)
   04662 B cell receptor signaling pathway
    101272095 (AKT2)
   04664 Fc epsilon RI signaling pathway
    101272095 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    101272095 (AKT2)
   04062 Chemokine signaling pathway
    101272095 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101272095 (AKT2)
   04922 Glucagon signaling pathway
    101272095 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    101272095 (AKT2)
   04920 Adipocytokine signaling pathway
    101272095 (AKT2)
   04929 GnRH secretion
    101272095 (AKT2)
   04915 Estrogen signaling pathway
    101272095 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    101272095 (AKT2)
   04917 Prolactin signaling pathway
    101272095 (AKT2)
   04926 Relaxin signaling pathway
    101272095 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    101272095 (AKT2)
   04919 Thyroid hormone signaling pathway
    101272095 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101272095 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101272095 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    101272095 (AKT2)
   04728 Dopaminergic synapse
    101272095 (AKT2)
   04722 Neurotrophin signaling pathway
    101272095 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101272095 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    101272095 (AKT2)
   04213 Longevity regulating pathway - multiple species
    101272095 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101272095 (AKT2)
   05205 Proteoglycans in cancer
    101272095 (AKT2)
   05230 Central carbon metabolism in cancer
    101272095 (AKT2)
   05231 Choline metabolism in cancer
    101272095 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101272095 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101272095 (AKT2)
   05212 Pancreatic cancer
    101272095 (AKT2)
   05225 Hepatocellular carcinoma
    101272095 (AKT2)
   05226 Gastric cancer
    101272095 (AKT2)
   05214 Glioma
    101272095 (AKT2)
   05221 Acute myeloid leukemia
    101272095 (AKT2)
   05220 Chronic myeloid leukemia
    101272095 (AKT2)
   05218 Melanoma
    101272095 (AKT2)
   05211 Renal cell carcinoma
    101272095 (AKT2)
   05215 Prostate cancer
    101272095 (AKT2)
   05213 Endometrial cancer
    101272095 (AKT2)
   05224 Breast cancer
    101272095 (AKT2)
   05222 Small cell lung cancer
    101272095 (AKT2)
   05223 Non-small cell lung cancer
    101272095 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101272095 (AKT2)
   05017 Spinocerebellar ataxia
    101272095 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101272095 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101272095 (AKT2)
   04931 Insulin resistance
    101272095 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101272095 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101272095 (AKT2)
   05135 Yersinia infection
    101272095 (AKT2)
   05152 Tuberculosis
    101272095 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101272095 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    101272095 (AKT2)
   05161 Hepatitis B
    101272095 (AKT2)
   05160 Hepatitis C
    101272095 (AKT2)
   05164 Influenza A
    101272095 (AKT2)
   05162 Measles
    101272095 (AKT2)
   05168 Herpes simplex virus 1 infection
    101272095 (AKT2)
   05163 Human cytomegalovirus infection
    101272095 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101272095 (AKT2)
   05169 Epstein-Barr virus infection
    101272095 (AKT2)
   05165 Human papillomavirus infection
    101272095 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101272095 (AKT2)
   05142 Chagas disease
    101272095 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101272095 (AKT2)
   01524 Platinum drug resistance
    101272095 (AKT2)
   01522 Endocrine resistance
    101272095 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101272095 (AKT2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101272095 (AKT2)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101272095 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7
Other DBs
NCBI-GeneID: 101272095
NCBI-ProteinID: XP_012389022
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
VSDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDATEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggatataaggag
cggcccgaggcccccgaccagaccctgccccccttaaacaacttctctgttgcagaatgc
cagctgatgaagactgagagaccgcggcccaacaccttcgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccatgtagactctccggatgagagggaggagtggatg
caggccatccaaatggttgccaacagcctcaagcagcggggcccaggtgaggatcccatg
gactacaagtgtggctcccccagcgactcttctgcagccgaggagatggaagtggcagtt
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaagctcctgggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccagtggccgctactacgccatg
aagatcttgcggaaggaggttatcattgctaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ctgtcccgggaacgcgtcttcacggaggagcgggcccgcttttatggtgcggagatcgtc
tcagccctggagtacctgcactcgcgggacgtggtgtaccgtgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgacttcggcctgtgcaaagagggc
gtcagtgacggggccaccatgaaaaccttctgtgggacccctgaatacctggcgcccgag
gtgctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagtgatgcc
acggaggtcatggagcacaggttcttcctcagtatcaactggcaggacgtggtgcagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggttgacacaaggtactttgac
gacgagttcaccgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc
ttactcgaactggaccagcggacccacttcccccagttctcctattcggccagcatccga
gagtga

KEGG   Orcinus orca (killer whale): 101273316
Entry
101273316         CDS       T05247                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04728  Dopaminergic synapse
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04920  Adipocytokine signaling pathway
oor04922  Glucagon signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101273316 (AKT1)
   04012 ErbB signaling pathway
    101273316 (AKT1)
   04014 Ras signaling pathway
    101273316 (AKT1)
   04015 Rap1 signaling pathway
    101273316 (AKT1)
   04370 VEGF signaling pathway
    101273316 (AKT1)
   04371 Apelin signaling pathway
    101273316 (AKT1)
   04630 JAK-STAT signaling pathway
    101273316 (AKT1)
   04668 TNF signaling pathway
    101273316 (AKT1)
   04066 HIF-1 signaling pathway
    101273316 (AKT1)
   04068 FoxO signaling pathway
    101273316 (AKT1)
   04072 Phospholipase D signaling pathway
    101273316 (AKT1)
   04071 Sphingolipid signaling pathway
    101273316 (AKT1)
   04024 cAMP signaling pathway
    101273316 (AKT1)
   04022 cGMP-PKG signaling pathway
    101273316 (AKT1)
   04151 PI3K-Akt signaling pathway
    101273316 (AKT1)
   04152 AMPK signaling pathway
    101273316 (AKT1)
   04150 mTOR signaling pathway
    101273316 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101273316 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    101273316 (AKT1)
   04218 Cellular senescence
    101273316 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101273316 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101273316 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101273316 (AKT1)
   04613 Neutrophil extracellular trap formation
    101273316 (AKT1)
   04620 Toll-like receptor signaling pathway
    101273316 (AKT1)
   04625 C-type lectin receptor signaling pathway
    101273316 (AKT1)
   04660 T cell receptor signaling pathway
    101273316 (AKT1)
   04662 B cell receptor signaling pathway
    101273316 (AKT1)
   04664 Fc epsilon RI signaling pathway
    101273316 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    101273316 (AKT1)
   04062 Chemokine signaling pathway
    101273316 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101273316 (AKT1)
   04922 Glucagon signaling pathway
    101273316 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    101273316 (AKT1)
   04920 Adipocytokine signaling pathway
    101273316 (AKT1)
   04929 GnRH secretion
    101273316 (AKT1)
   04915 Estrogen signaling pathway
    101273316 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    101273316 (AKT1)
   04917 Prolactin signaling pathway
    101273316 (AKT1)
   04926 Relaxin signaling pathway
    101273316 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    101273316 (AKT1)
   04919 Thyroid hormone signaling pathway
    101273316 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101273316 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101273316 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    101273316 (AKT1)
   04728 Dopaminergic synapse
    101273316 (AKT1)
   04722 Neurotrophin signaling pathway
    101273316 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101273316 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    101273316 (AKT1)
   04213 Longevity regulating pathway - multiple species
    101273316 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101273316 (AKT1)
   05205 Proteoglycans in cancer
    101273316 (AKT1)
   05230 Central carbon metabolism in cancer
    101273316 (AKT1)
   05231 Choline metabolism in cancer
    101273316 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101273316 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101273316 (AKT1)
   05212 Pancreatic cancer
    101273316 (AKT1)
   05225 Hepatocellular carcinoma
    101273316 (AKT1)
   05226 Gastric cancer
    101273316 (AKT1)
   05214 Glioma
    101273316 (AKT1)
   05221 Acute myeloid leukemia
    101273316 (AKT1)
   05220 Chronic myeloid leukemia
    101273316 (AKT1)
   05218 Melanoma
    101273316 (AKT1)
   05211 Renal cell carcinoma
    101273316 (AKT1)
   05215 Prostate cancer
    101273316 (AKT1)
   05213 Endometrial cancer
    101273316 (AKT1)
   05224 Breast cancer
    101273316 (AKT1)
   05222 Small cell lung cancer
    101273316 (AKT1)
   05223 Non-small cell lung cancer
    101273316 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101273316 (AKT1)
   05017 Spinocerebellar ataxia
    101273316 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101273316 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101273316 (AKT1)
   04931 Insulin resistance
    101273316 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101273316 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101273316 (AKT1)
   05135 Yersinia infection
    101273316 (AKT1)
   05152 Tuberculosis
    101273316 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101273316 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    101273316 (AKT1)
   05161 Hepatitis B
    101273316 (AKT1)
   05160 Hepatitis C
    101273316 (AKT1)
   05164 Influenza A
    101273316 (AKT1)
   05162 Measles
    101273316 (AKT1)
   05168 Herpes simplex virus 1 infection
    101273316 (AKT1)
   05163 Human cytomegalovirus infection
    101273316 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101273316 (AKT1)
   05169 Epstein-Barr virus infection
    101273316 (AKT1)
   05165 Human papillomavirus infection
    101273316 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101273316 (AKT1)
   05142 Chagas disease
    101273316 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101273316 (AKT1)
   01524 Platinum drug resistance
    101273316 (AKT1)
   01522 Endocrine resistance
    101273316 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101273316 (AKT1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101273316 (AKT1)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101273316 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101273316
NCBI-ProteinID: XP_004262497
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPGENSGAEEMEVALAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQIITITPPDRDDSMEGVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaaacgaggtgagtacatcaag
acctggcggccccggtacttcctcctgaagaacgacggcaccttcatcggctacaaggag
cggccgcaggacgtggagcagcgcgagtcgcccctgaacaacttctccgtggcgcaatgc
cagctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgtctgcagtgg
accacggtcatcgagcgcacgttccacgtagagacccccgaggagcgggaggagtggaca
accgccatccagacggtggccgacgggctcaagaggcaggaggaggagatgatggacttc
cggtcgggctcgcctggcgagaactcaggggccgaggagatggaggtggcgctggccaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactatgccatgaagatc
ctgaagaaggaggtcattgtggccaaggacgaggtggcccacacgctcacggagaaccgc
gtcctccagaactcccggcaccccttcctgacggccctgaagtactccttccagacccac
gaccgcctgtgcttcgtcatggagtacgccaacggaggcgagctcttcttccacctgtcc
cgggagcgggtgttccccgaggaccgggcccggttctacggcgccgagatcgtgtctgcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcacggacttcgggctgtgcaaggagggcatc
aaggatggcgccaccatgaagaccttctgcgggacgcccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagcttttcgagctc
atcctcatggaggagatccgcttcccacgcacgctcagccctgaggccaagtccctgctc
tcagggctgctcaagaaggaccccaagcagcggctcggtgggggctccgaggacgccaag
gagatcatgcagcaccgcttcttcgccagcatcgtgtggcaggatgtgtatgagaagaag
ctcagcccacccttcaagcctcaggtcacgtccgagacggacaccaggtattttgacgaa
gagttcacagcccagattatcaccatcacgccgcccgaccgagacgacagcatggagggc
gtggacagcgaacggaggcctcacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Orcinus orca (killer whale): 101288103
Entry
101288103         CDS       T05247                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04728  Dopaminergic synapse
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04920  Adipocytokine signaling pathway
oor04922  Glucagon signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101288103 (AKT3)
   04012 ErbB signaling pathway
    101288103 (AKT3)
   04014 Ras signaling pathway
    101288103 (AKT3)
   04015 Rap1 signaling pathway
    101288103 (AKT3)
   04370 VEGF signaling pathway
    101288103 (AKT3)
   04371 Apelin signaling pathway
    101288103 (AKT3)
   04630 JAK-STAT signaling pathway
    101288103 (AKT3)
   04668 TNF signaling pathway
    101288103 (AKT3)
   04066 HIF-1 signaling pathway
    101288103 (AKT3)
   04068 FoxO signaling pathway
    101288103 (AKT3)
   04072 Phospholipase D signaling pathway
    101288103 (AKT3)
   04071 Sphingolipid signaling pathway
    101288103 (AKT3)
   04024 cAMP signaling pathway
    101288103 (AKT3)
   04022 cGMP-PKG signaling pathway
    101288103 (AKT3)
   04151 PI3K-Akt signaling pathway
    101288103 (AKT3)
   04152 AMPK signaling pathway
    101288103 (AKT3)
   04150 mTOR signaling pathway
    101288103 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101288103 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    101288103 (AKT3)
   04218 Cellular senescence
    101288103 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101288103 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101288103 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101288103 (AKT3)
   04613 Neutrophil extracellular trap formation
    101288103 (AKT3)
   04620 Toll-like receptor signaling pathway
    101288103 (AKT3)
   04625 C-type lectin receptor signaling pathway
    101288103 (AKT3)
   04660 T cell receptor signaling pathway
    101288103 (AKT3)
   04662 B cell receptor signaling pathway
    101288103 (AKT3)
   04664 Fc epsilon RI signaling pathway
    101288103 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    101288103 (AKT3)
   04062 Chemokine signaling pathway
    101288103 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101288103 (AKT3)
   04922 Glucagon signaling pathway
    101288103 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    101288103 (AKT3)
   04920 Adipocytokine signaling pathway
    101288103 (AKT3)
   04929 GnRH secretion
    101288103 (AKT3)
   04915 Estrogen signaling pathway
    101288103 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    101288103 (AKT3)
   04917 Prolactin signaling pathway
    101288103 (AKT3)
   04926 Relaxin signaling pathway
    101288103 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    101288103 (AKT3)
   04919 Thyroid hormone signaling pathway
    101288103 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101288103 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101288103 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    101288103 (AKT3)
   04728 Dopaminergic synapse
    101288103 (AKT3)
   04722 Neurotrophin signaling pathway
    101288103 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101288103 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    101288103 (AKT3)
   04213 Longevity regulating pathway - multiple species
    101288103 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101288103 (AKT3)
   05205 Proteoglycans in cancer
    101288103 (AKT3)
   05230 Central carbon metabolism in cancer
    101288103 (AKT3)
   05231 Choline metabolism in cancer
    101288103 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101288103 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101288103 (AKT3)
   05212 Pancreatic cancer
    101288103 (AKT3)
   05225 Hepatocellular carcinoma
    101288103 (AKT3)
   05226 Gastric cancer
    101288103 (AKT3)
   05214 Glioma
    101288103 (AKT3)
   05221 Acute myeloid leukemia
    101288103 (AKT3)
   05220 Chronic myeloid leukemia
    101288103 (AKT3)
   05218 Melanoma
    101288103 (AKT3)
   05211 Renal cell carcinoma
    101288103 (AKT3)
   05215 Prostate cancer
    101288103 (AKT3)
   05213 Endometrial cancer
    101288103 (AKT3)
   05224 Breast cancer
    101288103 (AKT3)
   05222 Small cell lung cancer
    101288103 (AKT3)
   05223 Non-small cell lung cancer
    101288103 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101288103 (AKT3)
   05017 Spinocerebellar ataxia
    101288103 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101288103 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101288103 (AKT3)
   04931 Insulin resistance
    101288103 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101288103 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101288103 (AKT3)
   05135 Yersinia infection
    101288103 (AKT3)
   05152 Tuberculosis
    101288103 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101288103 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    101288103 (AKT3)
   05161 Hepatitis B
    101288103 (AKT3)
   05160 Hepatitis C
    101288103 (AKT3)
   05164 Influenza A
    101288103 (AKT3)
   05162 Measles
    101288103 (AKT3)
   05168 Herpes simplex virus 1 infection
    101288103 (AKT3)
   05163 Human cytomegalovirus infection
    101288103 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101288103 (AKT3)
   05169 Epstein-Barr virus infection
    101288103 (AKT3)
   05165 Human papillomavirus infection
    101288103 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101288103 (AKT3)
   05142 Chagas disease
    101288103 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101288103 (AKT3)
   01524 Platinum drug resistance
    101288103 (AKT3)
   01522 Endocrine resistance
    101288103 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101288103 (AKT3)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101288103 (AKT3)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101288103 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 101288103
NCBI-ProteinID: XP_004284558
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCTDSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagacactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactccagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaagcaagtggaaaatactatgctatgaagattctgaag
aaagaagttattattgccaaggatgaagtggcacacactttaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
agggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacgttctgtggtacaccggaatatctggcaccagaggtgttggaagat
aatgactatggccgagccgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgcgggaggttacctttctacaaccaggatcatgagaaactttttgaactaattctaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatactttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgatgaggacggtatggactgcacg
gacagtgagaggcggccgcatttccctcagttttcctactctgcaagcggacgagaataa

DBGET integrated database retrieval system