KEGG   Orcinus orca (killer whale): 101272130
Entry
101272130         CDS       T05247                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor05171  Coronavirus disease - COVID-19
oor05205  Proteoglycans in cancer
oor05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101272130 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101272130 (HBEGF)
   04915 Estrogen signaling pathway
    101272130 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    101272130 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101272130 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    101272130 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101272130 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101272130 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101272130 (HBEGF)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101272130 (HBEGF)
SSDB
Motif
Pfam: EGF Ninjurin NdhL
Other DBs
NCBI-GeneID: 101272130
NCBI-ProteinID: XP_004280331
LinkDB
Position
Unknown
AA seq 208 aa
MKLLPSVVLKLLLAAVLSALVTGDSLERLRRGLAAGTSNLDSPTQSTDQLLPPGGGRGRE
VLDLEETDLDLFRAAFSSKPQALATPSKEERGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHLGYHGERCHGLSLPVKNRLYTYDHTTILVVVVVVLSSVCLLVIVG
LLMFWYHRRGGYDVENEEKVKLGMTTSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctccttttggctgcagtgctctcggcgttg
gtgaccggcgacagcctggagcggcttcgaagagggctggcggctggaaccagcaatctg
gactcccctactcaatctacggaccagctgctgcccccgggaggtggccgaggccgggaa
gtcctggacttggaagagacagacctggaccttttcagagctgctttctcttccaagcca
caagctctggccacaccgagcaaggaggagcgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagagacccatgtcttcggaaatacaaggacttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccatcctgcatctgccacctgggttaccatgga
gagaggtgccatgggctgagcctcccagtgaaaaatcgtttatatacctatgatcacacg
accatcctggttgtggtggtcgtggttctgtcatccgtctgtctgctggtcatcgtgggg
cttctcatgttttggtaccacaggagaggaggttatgacgtggaaaatgaagagaaagtg
aaattgggcatgactacgtcccactga

DBGET integrated database retrieval system