KEGG   Orcinus orca (killer whale): 101272326
Entry
101272326         CDS       T05247                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04024  cAMP signaling pathway
oor04260  Cardiac muscle contraction
oor04261  Adrenergic signaling in cardiomyocytes
oor04371  Apelin signaling pathway
oor04810  Regulation of actin cytoskeleton
oor04919  Thyroid hormone signaling pathway
oor04970  Salivary secretion
oor04971  Gastric acid secretion
oor04972  Pancreatic secretion
oor04976  Bile secretion
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101272326 (SLC9A1)
   04024 cAMP signaling pathway
    101272326 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101272326 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101272326 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101272326 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    101272326 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    101272326 (SLC9A1)
   04971 Gastric acid secretion
    101272326 (SLC9A1)
   04972 Pancreatic secretion
    101272326 (SLC9A1)
   04976 Bile secretion
    101272326 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101272326 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101272326 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oor02000]
    101272326 (SLC9A1)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101272326 (SLC9A1)
Transporters [BR:oor02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   101272326 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 101272326
NCBI-ProteinID: XP_004266668
LinkDB
Position
Unknown
AA seq 815 aa
MLLWSGVCGLSPPRIFPSLLVAVALVGLLPVLRSHGLQPSPTASTIRGSEPPRERSIGEV
TTAPPELAPESRPVNHSFTEHSLKSRKVFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLENLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDRVGIVDIVLGFLSFFV
VSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLQRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITID
PASPQSPESVDLVNEELKGKVLGLNRDPGRVAKEDHEDDRGIMMRTKELSSPGTDDVFTP
ASSDSPSSQRMQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgcttctctggtctggtgtctgtggcctctctccgcctcgaatcttcccttcgctgctt
gtggcagtagccttggtggggctgctacccgttcttagaagccatggtctccagcccagc
cctactgccagcaccatcagaggctcagagccgccacgggaacgctccattggggaggtc
accaccgccccgccggagctcgcccccgagagccgccctgttaaccattccttcactgaa
cacagcctgaaatctcgaaaggtctttccagtcctgggcatcgactacacacacgtgcgc
acacccttcgaaatctccctctggatcctgctggcctgccttatgaagataggtttccac
gtgatccccaccatctcgagcattgtcccggagagctgcctactgatcgtggtggggctg
ctggtggggggcctgatcaagggcgtgggtgagacgccccccttcctgcagtcagacgtc
ttcttcctcttcctgctgccgcctatcatcctggatgcgggctacttcctgcccctgcgg
cagttcacagagaacctgggcaccatcctgatcttcgctgtggtgggcacgctgtggaat
gccttcttcctgggcggcctcatgtacgccgtgtgcctggtgggcggcgagcagatcaac
aacatcggcctcctggaaaacctgctcttcggcagcatcatttcagccgtggaccccgtg
gccgtgctggccgtcttcgaggaaattcacatcaatgagctgctgcacatccttgtcttc
ggggagtccctgctcaatgacgccgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaccgcgtgggcatcgtggacatcgtcctcggcttcctgagcttctttgtg
gtgtccctgggcggggtgtttgtgggcgtggtctacggggtcatcgcagccttcacctcc
cggttcacctcccacatccgcgtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacctgtcagccgagctcttccacctgtcgggcatcatggcactcattgcctcggga
gtggtgatgcgcccctacgtggaggccaacatctcccacaagtcccacacgaccatcaag
tatttcctgaagatgtggagcagcgtcagcgagaccctcatcttcatcttcctcggcgtc
tccaccgtggccggctcccaccactggaactggacctttgtcatcagcaccctgctcttc
tgcctcatcgcccgagtgctgggcgtgctgggcctgacctggttcatcaacaagttccgc
atcgtgaaactgacccccaaggaccagttcatcattgcctacgggggcctgcgaggggcc
atcgccttctccctgggctacctcctggacaagaagcactttcccatgtgtgacctgttc
ctcacggccatcatcaccgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtagacctcctggctgtgaagaaaaagcaagaaacgaagcgctccatcaacgag
gagatccacactcagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tacggccaccaccactggaaggacaagctcaatcggtttaataagaagtatgtgaagaag
tgtctgatagctggcgagcgctccaaggagccccagcttatcgctttctaccacaagatg
gagatgaagcaggctatcgagctggtggaaagtgggggcatgggcaagatcccctctgcc
gtctccaccgtctccatgcagaacatccaccccaagtccctgcctgccgagcgcatcctg
ccagcactgtccaaggacaaggaagaggagatccgcaaaatcctgaggaataacttgcag
aagaccaggcagcggctgcggtcctacaacagacacacgctggtggcagacccctacgag
gaggcctggaaccagatgctgctccagagacagaaggcccggcaactggagcagaagatc
aacaactacctgacggtgccggcccacaagctggactcgcccaccatgtcgcgggcccgc
attggctcagacccgctggcctatgagccgaaggccgacttgcctgtgatcaccatcgac
ccagcctccccgcagtcacctgagtctgtggacctggtgaacgaggagctgaagggcaag
gtcttggggctgaaccgggatccaggaagggtggccaaggaggaccacgaggacgacagg
ggcatcatgatgcggaccaaggagctctcgtccccgggcaccgacgacgtcttcacccct
gcgtcaagtgacagccccagctcccagaggatgcagcgctgcctcagtgacccaggcccc
catcctgagcctggggagggcgagcctttcatccccaagggccagtag

DBGET integrated database retrieval system