KEGG   Orcinus orca (killer whale): 101272376
Entry
101272376         CDS       T05247                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04020  Calcium signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04114  Oocyte meiosis
oor04140  Autophagy - animal
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04310  Wnt signaling pathway
oor04340  Hedgehog signaling pathway
oor04371  Apelin signaling pathway
oor04530  Tight junction
oor04540  Gap junction
oor04611  Platelet activation
oor04713  Circadian entrainment
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04723  Retrograde endocannabinoid signaling
oor04724  Glutamatergic synapse
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04727  GABAergic synapse
oor04728  Dopaminergic synapse
oor04740  Olfactory transduction
oor04742  Taste transduction
oor04750  Inflammatory mediator regulation of TRP channels
oor04910  Insulin signaling pathway
oor04911  Insulin secretion
oor04912  GnRH signaling pathway
oor04913  Ovarian steroidogenesis
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04918  Thyroid hormone synthesis
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04922  Glucagon signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04924  Renin secretion
oor04925  Aldosterone synthesis and secretion
oor04926  Relaxin signaling pathway
oor04927  Cortisol synthesis and secretion
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor04961  Endocrine and other factor-regulated calcium reabsorption
oor04962  Vasopressin-regulated water reabsorption
oor04970  Salivary secretion
oor04971  Gastric acid secretion
oor04976  Bile secretion
oor05012  Parkinson disease
oor05020  Prion disease
oor05030  Cocaine addiction
oor05031  Amphetamine addiction
oor05032  Morphine addiction
oor05034  Alcoholism
oor05146  Amoebiasis
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101272376 (PRKACA)
   04014 Ras signaling pathway
    101272376 (PRKACA)
   04310 Wnt signaling pathway
    101272376 (PRKACA)
   04340 Hedgehog signaling pathway
    101272376 (PRKACA)
   04371 Apelin signaling pathway
    101272376 (PRKACA)
   04020 Calcium signaling pathway
    101272376 (PRKACA)
   04024 cAMP signaling pathway
    101272376 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101272376 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101272376 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101272376 (PRKACA)
   04540 Gap junction
    101272376 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101272376 (PRKACA)
   04062 Chemokine signaling pathway
    101272376 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    101272376 (PRKACA)
   04910 Insulin signaling pathway
    101272376 (PRKACA)
   04922 Glucagon signaling pathway
    101272376 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    101272376 (PRKACA)
   04912 GnRH signaling pathway
    101272376 (PRKACA)
   04913 Ovarian steroidogenesis
    101272376 (PRKACA)
   04915 Estrogen signaling pathway
    101272376 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    101272376 (PRKACA)
   04921 Oxytocin signaling pathway
    101272376 (PRKACA)
   04926 Relaxin signaling pathway
    101272376 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    101272376 (PRKACA)
   04918 Thyroid hormone synthesis
    101272376 (PRKACA)
   04919 Thyroid hormone signaling pathway
    101272376 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    101272376 (PRKACA)
   04916 Melanogenesis
    101272376 (PRKACA)
   04924 Renin secretion
    101272376 (PRKACA)
   04925 Aldosterone synthesis and secretion
    101272376 (PRKACA)
   04927 Cortisol synthesis and secretion
    101272376 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101272376 (PRKACA)
   04270 Vascular smooth muscle contraction
    101272376 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    101272376 (PRKACA)
   04971 Gastric acid secretion
    101272376 (PRKACA)
   04976 Bile secretion
    101272376 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101272376 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101272376 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101272376 (PRKACA)
   04727 GABAergic synapse
    101272376 (PRKACA)
   04725 Cholinergic synapse
    101272376 (PRKACA)
   04728 Dopaminergic synapse
    101272376 (PRKACA)
   04726 Serotonergic synapse
    101272376 (PRKACA)
   04720 Long-term potentiation
    101272376 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    101272376 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    101272376 (PRKACA)
   04742 Taste transduction
    101272376 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    101272376 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    101272376 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    101272376 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101272376 (PRKACA)
   04714 Thermogenesis
    101272376 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101272376 (PRKACA)
   05205 Proteoglycans in cancer
    101272376 (PRKACA)
   05203 Viral carcinogenesis
    101272376 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101272376 (PRKACA)
   05020 Prion disease
    101272376 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    101272376 (PRKACA)
   05031 Amphetamine addiction
    101272376 (PRKACA)
   05032 Morphine addiction
    101272376 (PRKACA)
   05034 Alcoholism
    101272376 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101272376 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101272376 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101272376 (PRKACA)
   05163 Human cytomegalovirus infection
    101272376 (PRKACA)
   05165 Human papillomavirus infection
    101272376 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101272376 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101272376 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101272376 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oor03019]
    101272376 (PRKACA)
   03036 Chromosome and associated proteins [BR:oor03036]
    101272376 (PRKACA)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101272376 (PRKACA)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  PKA family
   101272376 (PRKACA)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101272376 (PRKACA)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101272376 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 101272376
NCBI-ProteinID: XP_004277471
LinkDB
Position
Unknown
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSISEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgcggccaagaagggcagcgagcaagagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ctggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaagcacaaggagaccgggaaccacttcgccatgaagatcctcgacaaacagaaggtg
gtaaagctgaagcagatcgagcacaccctgaacgaaaagcgcatcctgcaagcggtcaac
tttccgttccttgtcaaactcgagttctcgttcaaggacaactcaaatttatacatgatc
atggagtacgtgcctggtggggagatgttctcacacctgcggcggatcgggaggttcagt
gagccccatgcccgcttctacgcagcccagatcgtcctgacctttgagtacctgcactcg
ctcgatctcatctaccgggacctgaagccggagaacctccttatcgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgc
ggcacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggttctcatctatgagatggccgctggctacccgcccttcttc
gctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccgtcc
cacttcagctccgacctgaaggatctgctgcggaaccttctgcaggtggacctcaccaaa
cgctttgggaacctcaagaacggggtcaatgacatcaagaaccacaagtggtttgccacg
accgactggatcgccatctaccaaaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgagtctccatc
agtgagaagtgtggcaaggagttttctgagttttag

KEGG   Orcinus orca (killer whale): 101273911
Entry
101273911         CDS       T05247                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04020  Calcium signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04114  Oocyte meiosis
oor04140  Autophagy - animal
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04310  Wnt signaling pathway
oor04340  Hedgehog signaling pathway
oor04371  Apelin signaling pathway
oor04530  Tight junction
oor04540  Gap junction
oor04611  Platelet activation
oor04713  Circadian entrainment
oor04714  Thermogenesis
oor04720  Long-term potentiation
oor04723  Retrograde endocannabinoid signaling
oor04724  Glutamatergic synapse
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04727  GABAergic synapse
oor04728  Dopaminergic synapse
oor04740  Olfactory transduction
oor04742  Taste transduction
oor04750  Inflammatory mediator regulation of TRP channels
oor04910  Insulin signaling pathway
oor04911  Insulin secretion
oor04912  GnRH signaling pathway
oor04913  Ovarian steroidogenesis
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04918  Thyroid hormone synthesis
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04922  Glucagon signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04924  Renin secretion
oor04925  Aldosterone synthesis and secretion
oor04926  Relaxin signaling pathway
oor04927  Cortisol synthesis and secretion
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor04961  Endocrine and other factor-regulated calcium reabsorption
oor04962  Vasopressin-regulated water reabsorption
oor04970  Salivary secretion
oor04971  Gastric acid secretion
oor04976  Bile secretion
oor05012  Parkinson disease
oor05020  Prion disease
oor05030  Cocaine addiction
oor05031  Amphetamine addiction
oor05032  Morphine addiction
oor05034  Alcoholism
oor05146  Amoebiasis
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101273911 (PRKACB)
   04014 Ras signaling pathway
    101273911 (PRKACB)
   04310 Wnt signaling pathway
    101273911 (PRKACB)
   04340 Hedgehog signaling pathway
    101273911 (PRKACB)
   04371 Apelin signaling pathway
    101273911 (PRKACB)
   04020 Calcium signaling pathway
    101273911 (PRKACB)
   04024 cAMP signaling pathway
    101273911 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101273911 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101273911 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101273911 (PRKACB)
   04540 Gap junction
    101273911 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101273911 (PRKACB)
   04062 Chemokine signaling pathway
    101273911 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    101273911 (PRKACB)
   04910 Insulin signaling pathway
    101273911 (PRKACB)
   04922 Glucagon signaling pathway
    101273911 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    101273911 (PRKACB)
   04912 GnRH signaling pathway
    101273911 (PRKACB)
   04913 Ovarian steroidogenesis
    101273911 (PRKACB)
   04915 Estrogen signaling pathway
    101273911 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    101273911 (PRKACB)
   04921 Oxytocin signaling pathway
    101273911 (PRKACB)
   04926 Relaxin signaling pathway
    101273911 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    101273911 (PRKACB)
   04918 Thyroid hormone synthesis
    101273911 (PRKACB)
   04919 Thyroid hormone signaling pathway
    101273911 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    101273911 (PRKACB)
   04916 Melanogenesis
    101273911 (PRKACB)
   04924 Renin secretion
    101273911 (PRKACB)
   04925 Aldosterone synthesis and secretion
    101273911 (PRKACB)
   04927 Cortisol synthesis and secretion
    101273911 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101273911 (PRKACB)
   04270 Vascular smooth muscle contraction
    101273911 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    101273911 (PRKACB)
   04971 Gastric acid secretion
    101273911 (PRKACB)
   04976 Bile secretion
    101273911 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101273911 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101273911 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101273911 (PRKACB)
   04727 GABAergic synapse
    101273911 (PRKACB)
   04725 Cholinergic synapse
    101273911 (PRKACB)
   04728 Dopaminergic synapse
    101273911 (PRKACB)
   04726 Serotonergic synapse
    101273911 (PRKACB)
   04720 Long-term potentiation
    101273911 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    101273911 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    101273911 (PRKACB)
   04742 Taste transduction
    101273911 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    101273911 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    101273911 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    101273911 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101273911 (PRKACB)
   04714 Thermogenesis
    101273911 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101273911 (PRKACB)
   05205 Proteoglycans in cancer
    101273911 (PRKACB)
   05203 Viral carcinogenesis
    101273911 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101273911 (PRKACB)
   05020 Prion disease
    101273911 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    101273911 (PRKACB)
   05031 Amphetamine addiction
    101273911 (PRKACB)
   05032 Morphine addiction
    101273911 (PRKACB)
   05034 Alcoholism
    101273911 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101273911 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101273911 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101273911 (PRKACB)
   05163 Human cytomegalovirus infection
    101273911 (PRKACB)
   05165 Human papillomavirus infection
    101273911 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101273911 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101273911 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101273911 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oor03019]
    101273911 (PRKACB)
   03036 Chromosome and associated proteins [BR:oor03036]
    101273911 (PRKACB)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101273911 (PRKACB)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  PKA family
   101273911 (PRKACB)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101273911 (PRKACB)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101273911 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 101273911
NCBI-ProteinID: XP_004262996
LinkDB
Position
Unknown
AA seq 397 aa
MAAYRELPCNQYTGTTALQKLEGFASRLFHRHSKGTAHDQKTTLENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaactaccctgtaatcagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacactccaaaggtactgcacatgatcag
aaaacaactctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttttaaaaaaatgggaaaatcct
gctccgaataatgctgggctggaagattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacaatattatgcaatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtattcttttaaggataat
tctaatttatacatggttatggaatatgtccctggtggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccatcaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagaaataattctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttccgga
aaggttcgattcccttctcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggacctgacgaagcggtttggaaatctaaagaatggtgtgagtgatataaaaact
cacaagtggtttgccacaactgattggattgctatttaccagaggaaggttgaagctcca
ttcataccaaagttcagaggctctggagataccagcaattttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtggaaaagaattttgtgaattttag

DBGET integrated database retrieval system