KEGG   Orcinus orca (killer whale): 101272428
Entry
101272428         CDS       T05247                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01523  Antifolate resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04062  Chemokine signaling pathway
oor04064  NF-kappa B signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04380  Osteoclast differentiation
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04623  Cytosolic DNA-sensing pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04668  TNF signaling pathway
oor04920  Adipocytokine signaling pathway
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05212  Pancreatic cancer
oor05215  Prostate cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05340  Primary immunodeficiency
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101272428 (IKBKG)
   04014 Ras signaling pathway
    101272428 (IKBKG)
   04064 NF-kappa B signaling pathway
    101272428 (IKBKG)
   04668 TNF signaling pathway
    101272428 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101272428 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101272428 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101272428 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101272428 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101272428 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101272428 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101272428 (IKBKG)
   04660 T cell receptor signaling pathway
    101272428 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101272428 (IKBKG)
   04659 Th17 cell differentiation
    101272428 (IKBKG)
   04657 IL-17 signaling pathway
    101272428 (IKBKG)
   04662 B cell receptor signaling pathway
    101272428 (IKBKG)
   04062 Chemokine signaling pathway
    101272428 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101272428 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101272428 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101272428 (IKBKG)
   05203 Viral carcinogenesis
    101272428 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101272428 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101272428 (IKBKG)
   05221 Acute myeloid leukemia
    101272428 (IKBKG)
   05220 Chronic myeloid leukemia
    101272428 (IKBKG)
   05215 Prostate cancer
    101272428 (IKBKG)
   05222 Small cell lung cancer
    101272428 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101272428 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101272428 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101272428 (IKBKG)
   05135 Yersinia infection
    101272428 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101272428 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101272428 (IKBKG)
   05162 Measles
    101272428 (IKBKG)
   05164 Influenza A
    101272428 (IKBKG)
   05161 Hepatitis B
    101272428 (IKBKG)
   05160 Hepatitis C
    101272428 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101272428 (IKBKG)
   05163 Human cytomegalovirus infection
    101272428 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101272428 (IKBKG)
   05169 Epstein-Barr virus infection
    101272428 (IKBKG)
   05165 Human papillomavirus infection
    101272428 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101272428 (IKBKG)
   05142 Chagas disease
    101272428 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101272428 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101272428 (IKBKG)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101272428 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ZapB LLC1 zf_C2H2_ZHX Bacillus_HBL
Other DBs
NCBI-GeneID: 101272428
NCBI-ProteinID: XP_012394913
LinkDB
Position
Unknown
AA seq 412 aa
MSRPPWKSPLCEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQAAPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQREEKAFLMQKFQEARDLVERLSLEKRELHRQREQ
ALQEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRVRAASEQ
ARQLENEREALQQQHSVQVDQLRLQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSMGLQLEDLKQQLKQAEEALVAKQELIDKLKEEAEQHKTVMETVPVLKAQADI
YKADFQAERQAREKLAEKKEFLQAQLEQLQREHNRLKTSCQESARIEDMRKRHVEVSQAP
LAPAPAHHSFHVALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggcccccttggaagagtccactgtgtgagatggtgcagcctagcggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagccatgctccac
ctgccttcagagcaggctgctcctgagaccttccagcgctgtctggaggagaatcaagag
ctccgagatgccatccgccagagcaaccagatgctgcgggaacgctgtgaggagctgcag
cgtttccagggcagccagagggaggagaaggccttcctcatgcagaagttccaggaggcc
cgggacctggtggagaggctgagcctggagaagcgggagctgcaccggcagagggagcag
gccctgcaggaggtggagcgcctcaagacatgccagcagcagatggccgaggacaaggcc
tcagtgaaagcccaggtgacgtccttgctgggggagctgcaggagagccagagccgcttg
gaggccgccaccaaggagcggcaggctttggagggcagggtccgggccgccagcgagcag
gcccggcagctggagaacgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcctgcagaaccagagcatggacgccgccctgcgcatggagcgccaggctgcc
tcggaggagaagaggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacagccacatcaagagcagcatgggattgcagctggaagatctcaagcagcagctc
aagcaggccgaggaggccctggtggctaaacaggagctgatcgacaaactgaaggaagag
gctgagcaacacaagactgtgatggagacggttccggtgctgaaagcccaggcggatatc
tacaaggcggatttccaggctgagaggcaggcccgggagaagctggctgagaagaaggag
ttcctgcaggcgcagctggagcagctgcagagggagcacaacaggctgaagaccagctgt
caggagtcggccaggatcgaagacatgaggaagcggcatgtagaggtctcccaggccccc
ttagcccctgccccagctcatcactcctttcacgtggccctgcccagccagaggagaagc
ccccctgaagagccgcccaacttctgctgccccaagtgccagtatcaggctcctgacatg
gacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system