KEGG   Orcinus orca (killer whale): 101272740
Entry
101272740         CDS       T05247                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X2
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04020  Calcium signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04260  Cardiac muscle contraction
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04713  Circadian entrainment
oor04720  Long-term potentiation
oor04723  Retrograde endocannabinoid signaling
oor04724  Glutamatergic synapse
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04727  GABAergic synapse
oor04728  Dopaminergic synapse
oor04742  Taste transduction
oor04911  Insulin secretion
oor04912  GnRH signaling pathway
oor04921  Oxytocin signaling pathway
oor04924  Renin secretion
oor04925  Aldosterone synthesis and secretion
oor04927  Cortisol synthesis and secretion
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05031  Amphetamine addiction
oor05410  Hypertrophic cardiomyopathy
oor05412  Arrhythmogenic right ventricular cardiomyopathy
oor05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101272740 (CACNA1C)
   04020 Calcium signaling pathway
    101272740 (CACNA1C)
   04024 cAMP signaling pathway
    101272740 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101272740 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101272740 (CACNA1C)
   04929 GnRH secretion
    101272740 (CACNA1C)
   04912 GnRH signaling pathway
    101272740 (CACNA1C)
   04921 Oxytocin signaling pathway
    101272740 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    101272740 (CACNA1C)
   04924 Renin secretion
    101272740 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101272740 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101272740 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101272740 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101272740 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101272740 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101272740 (CACNA1C)
   04727 GABAergic synapse
    101272740 (CACNA1C)
   04725 Cholinergic synapse
    101272740 (CACNA1C)
   04728 Dopaminergic synapse
    101272740 (CACNA1C)
   04726 Serotonergic synapse
    101272740 (CACNA1C)
   04720 Long-term potentiation
    101272740 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101272740 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101272740 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101272740 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101272740 (CACNA1C)
   05020 Prion disease
    101272740 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    101272740 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101272740 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101272740 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101272740 (CACNA1C)
   05414 Dilated cardiomyopathy
    101272740 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101272740 (CACNA1C)
   04934 Cushing syndrome
    101272740 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oor04040]
    101272740 (CACNA1C)
Ion channels [BR:oor04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101272740 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101272740
NCBI-ProteinID: XP_004286292
LinkDB
Position
Unknown
AA seq 2188 aa
MVNENTRMYIPEENHQGPSYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTMATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVVA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSETESVNTENVA
GGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKRQEVVEKPAVEETKEEKIELKSITADGESPPATKINMDDLQPNENEDKSSYPNL
ETTGTNEEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDS
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYVTYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGHFSDPWNVFDCLIVIGSVIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGSSAEGEAPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPPQRNALSLQAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVGYYPSDSRSTFPQTFTTQRPLHISKAGTSQGDAESPSHEKLVDST
FTPSSYSSMGSNANINNANNTALGRCPCPAGQPGAVSISTVEGRGPPLSPAVQVQGASWR
LSSQRCPSRDSLIAMVCQDEAPRDETCGLRMDEDAEYGSEPSLICTEMLSYQDDENRQLA
PPEEDRRDIHLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDISQKTVLPLHLVHHQAL
AVAGLSPLLQRSHPPGALPPPHATPPATPGPAWPLRPVPTLRLEGAESSDKLTSSFPSVH
CGPWAGEPTPCGASGGIRRARPVSLTVPSPAGPQGRPFHGSASSLVEAVLISEGLGQFAQ
DPRFLKATTQELADACDMTIEEMESAADNILSGGARQSPNGTLLPCAHCRDPGPDREGGA
EDAAWAPSPEPRQGGEEPRDSRAFASSL
NT seq 6567 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacattccggaggaaaaccaccaaggtcccagctat
gggagcccgcgcccggctcacgccaacatgaatgccaacgcggccgcggggctggcacct
gagcacatccccacaccgggggccgccctgtcctggcaggcagccattgatgcggcccgg
caggccaagctgatgggcagcgctggcaacgccaccatctccacggtcagctccacgcag
cggaagcggcagcagtacgggaagcccaagaaacagggcagcacgatggccacgcgcccg
ccccgtgccctgctctgcctgaccctcaagaaccccatccggagggcatgcatcagcatc
gtggagtggaagccatttgaaatcattattttactgactatttttgccaactgtgtggcc
ttagcgatctacattcccttcccagaggacgactcgaacgccaccaactccaacctggaa
cgggtggagtatctctttctcatcatttttactgtggaagcatttttaaaagtcgtagcc
tacgggctgctctttcaccccaacgcttacctccgcaacggctggaacttgctggatttt
atcattgtggttgtcgggcttttcagtgcaatcttagagcaagccaccaaagccgacggg
gccaacgccctgggagggaagggggctggattcgacgtgaaggcgctcagggcgttccgc
gtgctgcggcctctgcggctggtgtccggggtcccgagtctccaggtggtcctgaactcc
atcatcaaggccatggtgccgctgctgcacatcgccctgctcgtgctcttcgtcattatc
atctacgccatcatcgggctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatcgcagatgtcccagcagaagacgacccctccccctgtgccctggagacg
ggccacggccggcagtgccagaatggcacggtgtgcaagccgggctgggatgggcccaag
cacggcatcaccaacttcgacaactttgccttcgccatgctgaccgtgttccagtgcatc
accatggagggctggaccgacgtcctctactgggtcaatgatgccgtgggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcgttttttgtacttaacttggtc
ctcggtgtccttagcggagagttttccaaagagagggagaaggccaaggcccggggcgac
ttccagaagctgcgggagaagcagcagctggaagaggacctgaagggctacctggactgg
atcacgcaggcggaggacatcgaccccgagaacgaggacgagggcttggacgaggagaaa
ccccgaaacatgagcatgcccaccagtgagaccgagtctgtcaacacggaaaacgtggct
ggaggcgacatcgagggagagagctgcggggccaggctggcccacaggatctccaagtcg
aagtttagccgctactggcgccgctggaatcggttctgcaggcggaagtgccgcgcggcc
gtgaagtcgagcgtcttctactggcttgtcatcttcctggttttcctcaacacgctcacc
atcgcctctgagcactacaaccagccccactggctcacggaagtccaagacacggccaac
aaggcgctgctggccctgttcacggcggagatgctgctcaagatgtacagcctggggctg
caggcctacttcgtgtccctgttcaaccgcttcgactgcttcatcgtgtgcggcggcatc
ctggagaccatcctggtggagaccaagatcatgtcgcccctgggcatctccgtgctgaga
tgcgtacgcctcctgcggatattcaagatcacgaggtactggaactccctgagcaacctg
gtggcgtccctgctgaactctgtgcgctccatcgcctccctgcttctgctgctgtttctt
ttcatcatcatcttctccctcctgggcatgcagctcttcggggggaagttcaactttgat
gagatgcagacccggaggagcacgttcgataacttcccccagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaatgtgttcttggccattgctgtggacaacctggctgacgccgag
agcctcacctctgcccagaaggaggaggaagaagagaaggagaggaagaagctggccagg
actgccagcccagagaagagacaagaggtggtggagaagccggccgtggaggagaccaag
gaggagaaaatcgagctgaaatccatcactgcggatggagagtccccccctgccaccaag
atcaacatggacgacctccagcccaacgagaatgaggacaagagttcctaccccaacctg
gaaaccacaggtaccaacgaggaggaggagcctgagatgcccgtgggcccccgtccccgc
cccctctctgagctgcacctgaaggagaaggcggtgcccatgccagaagccagcgccttc
ttcatcttcagcccgagcaacaggttccgcctccagtgccaccgcatcgtcaacgactcc
atcttcaccaacctgatcctcttcttcatcttgctcagcagcatctccctggctgctgag
gaccccgtccagcacacctccttcaggaaccacattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatcctaggcaacgcagactatgtcttc
actagtatctttacgttagaaattatcctcaagatgaccgcctacggggccttcctgcac
aagggctccttctgccggaactacttcaacatcctggacctactggtggtcagcgtgtcc
ctcatctccttcggcatccagtccagcgccatcaatgtggtgaagatcttgcgggtcctg
agggtgctgagacccctgagggccatcaacagggccaaggggctgaagcacgtggtgcag
tgcgtgttcgtggccatccgcaccatcgggaacatcgtgatcgtcaccacgctgctgcag
ttcatgttcgcctgcatcggggtccagctcttcaagggcaagctctacacctgctcggac
agttccaaacagacagaggccgaatgcaaggggaactacgtcacatacaaggacggggag
gtggatcaccccatcatccagccccgcagctgggagaacagcaagtttgactttgacaat
gtcctggcggctatgatggccctgttcaccgtctccacctttgaggggtggccagagctg
ctgtaccgctccatcgactcccacacggaggacaagggccccatttacaactaccgcgtg
gagatctccgtcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatc
ttcgtgggcttcgtcattgtcaccttccaggagcagggggagcaggagtacaagaactgc
gagctggacaagaaccagcggcagtgcgtggagtacgcgctgaaggcccggcccctgcgg
aggtacatccccaagaaccagcaccagtacaaggtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgtcctcatcctgctgaacaccatctgcctggccatgcagcac
tacgggcagagctgcctgttcaaaatcgccatgaacattctcaacatgctgttcaccggc
ctcttcacggtggagatgattctgaagctcattgccttcaagcccaagggccactttagt
gacccctggaatgtctttgactgcctcatcgtaattggcagcgtaattgacgtcattctc
agtgagacgaatcactatttctgtgatgcatggaacacgtttgacgccttgattgttgtt
ggtagcattgttgacatagccatcaccgaggtaaacccagctgaacatacccaatgctct
ccctttatgaacgcggaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgtctggtcaagctgctgagccgtggggagggcatccggacgctgctgtggacg
ttcatcaagtccttccaggccctgccctacgtcgccctcctgatcgtgatgctgttcttt
atctacgccgtcatcgggatgcaggtgttcgggaaaatcgccctgaatgacacgacagag
atcaacaggaacaacaacttccagaccttcccccaggctgtgctgctgctcttcaggtgc
gccaccggggaggcgtggcaggacatcatgctggcctgcatgccgggcaagaagtgcgcg
cccgagtcggagccgggcagcagcgccgagggggaggcgccctgcggcagcagcttcgcc
gtcttctacttcatcagcttctacatgctctgcgcctttctgatcatcaacctcttcgta
gctgtcatcatggacaactttgactacctgacaagggactggtccattctgggtccccac
cacctggacgaattcaagcgaatctgggcggagtatgatcctgaagccaagggtcgcatc
aagcacctggatgtggtgaccctgctccggaggattcagccgcccctgggctttgggaag
ctgtgcccgcaccgcgtggcgtgcaaacgcctggtctccatgaacatgcccctgaacagc
gacgggacggtcatgttcaacgccaccctgtttgccctggtccggacggccctgaggatc
aaaacggaagggaacctggaacaggccaacgaggagctgcgggccatcatcaagaagatc
tggaagcggaccagcatgaagctgctggaccaggtggttccgcctgcgggagatgatgag
gtcacggtgggcaagttttacgctactttcctgatccaagagtatttccggaaattcaag
aagcgcaaagagcagggcctggtgggcaagcccccccagaggaacgccctgtccctgcag
gctggtctgcgcaccctgcatgacctcgggcccgagatccgccgggccatctccggggac
ctgaccgccgaggaggagctggacaaggccatgaaggaggctgtgtccgcggcctcggaa
gatgacatcttcaggagggccggtggcctgttcggcaaccacgtgggctactaccccagc
gacagccggagcaccttcccccagaccttcaccacccagcgccctctgcacatcagcaag
gcgggcaccagccagggggacgcggagtcgccctcccacgagaaactggtggattccacc
ttcacccccagcagctactcgtccatgggttccaacgccaacatcaacaacgccaacaac
accgccctgggccgctgcccctgccctgccggccagcccggtgctgtcagcatcagcacc
gtggagggccgtgggccccccttgtctcctgctgtccaggtgcagggggcctcgtggagg
ctcagctcccagaggtgcccctcccgggacagcctgatagccatggtgtgtcaggacgag
gcccctcgggatgagacttgtggcctgaggatggatgaggacgccgagtacggcagcgag
cccagcctgatctgcacggagatgctctcctaccaggacgatgagaatcggcagctggcg
ccccccgaggaggacaggagagacatccatctctctccgaagaggggcttcctgcgctct
gcctccctaggtcgaagggcctccttccaccttgagtgtctgaagcgacagaagaatcca
gggggagacatctctcagaagacagttctgcctctgcatctcgttcaccatcaggcgctg
gcggtggcgggcctgagccccctcctgcagagaagccatccccctggcgccctccccccg
ccgcatgcaacgccccctgccacgcctggcccggcctggcccctgcggcctgtgcccacc
ctgcggctggagggggccgagtccagcgacaagctcaccagcagcttcccatccgtccac
tgcggcccctgggccggggagcccacgccctgcggggccagcggcggcatccggagggcc
cggcccgtgtccctcactgtgcccagcccggcagggccccagggccggcccttccacggc
agcgccagcagcctggtggaggcggtcttgatctcagaaggactggggcagtttgctcag
gatcccaggttcctcaaggccaccacccaggagctggccgacgcctgcgacatgaccatc
gaggagatggagagcgcggccgacaacatcctcagcgggggcgcccggcagagccccaac
ggtaccctgctcccgtgtgcacactgcagggacccggggccagaccgagaggggggcgcg
gaggacgcggcctgggcgcccagccccgagccccgccagggcggagaggagccccgggac
agcagggccttcgccagcagcctgtag

DBGET integrated database retrieval system