KEGG   Orcinus orca (killer whale): 101273605
Entry
101273605         CDS       T05247                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04022  cGMP-PKG signaling pathway
oor04141  Protein processing in endoplasmic reticulum
oor04151  PI3K-Akt signaling pathway
oor04211  Longevity regulating pathway
oor04261  Adrenergic signaling in cardiomyocytes
oor04668  TNF signaling pathway
oor04728  Dopaminergic synapse
oor04911  Insulin secretion
oor04915  Estrogen signaling pathway
oor04918  Thyroid hormone synthesis
oor04925  Aldosterone synthesis and secretion
oor04926  Relaxin signaling pathway
oor04927  Cortisol synthesis and secretion
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor05020  Prion disease
oor05030  Cocaine addiction
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101273605 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101273605 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101273605 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101273605 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101273605 (ATF6B)
   04915 Estrogen signaling pathway
    101273605 (ATF6B)
   04926 Relaxin signaling pathway
    101273605 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101273605 (ATF6B)
   04918 Thyroid hormone synthesis
    101273605 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101273605 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101273605 (ATF6B)
   04927 Cortisol synthesis and secretion
    101273605 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101273605 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101273605 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101273605 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101273605 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101273605 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101273605 (ATF6B)
   05031 Amphetamine addiction
    101273605 (ATF6B)
   05034 Alcoholism
    101273605 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101273605 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101273605 (ATF6B)
   05161 Hepatitis B
    101273605 (ATF6B)
   05163 Human cytomegalovirus infection
    101273605 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oor03000]
    101273605 (ATF6B)
Transcription factors [BR:oor03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101273605 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 101273605
NCBI-ProteinID: XP_012394864
LinkDB
Position
Unknown
AA seq 715 aa
MVGGGRGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYTGLDEVAEEQTQLFLCPEQ
DVPFDSSSLDLEMDVSPPEPPWDSLPIFPDLQVKSEPSSPSSSSSLSSESSRLSAEPSSQ
ASGVGEVLVVKSESLTPSLCLLGDDPTSPFETVQINVGPTSDDASDVQIKIEPVSPSSSI
NSEASLLSAESPNQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSG
KALPARKPPLQPKPVVITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEG
LTPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLE
ARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPV
SISEPPPAPISPRMSREEPRPQRHLLEFSAQEPVHRVEHPQHPSQGPKETQPSSTGQPSF
RNLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPQRP
QERQKSQLWKKSPPVKAVPTQPPGPPERDAVGQLQLYRQPDRSQPEFLDAIDRREDTFYV
VSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRV
IHIKTSTVPPSLRKQPSSSPGNATGGPLPASEASQAHQAARQPSTSIIPDLYDSH
NT seq 2148 nt   +upstreamnt  +downstreamnt
atggttgggggggggcgggggggaaagatggcggagctgatgctcctcagcgagattgcg
gacccgacgcgctttttcaccgacaatttgctgagcccggaggactgggacagcacctta
tacaccggcctggatgaagtggccgaggagcagacgcagctcttcctttgcccggagcag
gatgtcccgtttgacagcagttccctggacttggagatggatgtcagccctcctgaaccc
ccctgggactctctgcctatcttcccagatcttcaggtgaagtctgagccatcctccccc
tcctcttcctcctccctcagctctgaatcctcgcgcctttctgcagagccctccagccag
gcctctggtgtaggggaggtgctggtcgtgaagtcagagtccttgacaccctcactctgc
ctcctgggagatgatccaacatccccatttgaaaccgtccagatcaatgtgggccccacc
tctgatgatgcctcagatgttcagattaagatagagcctgtctctccatcttcctccatc
aactcagaggcttccctgctctctgcggagtcccccaaccaggcttttataggagaggag
gtactggaagtgaagacagagtccccatcccctcaagggtgtctcttgcgggatgtctca
ggccccccacttggagctgtccagatcagcatgggcctgtcctctgatggctcctcaggc
aaagccctgcccgcccggaagccaccactgcagcccaaacctgtggtgataaccactgtc
ccgatgccaccgagagctgtgcctcccagcaccactgtccttctgcagccccttgtccag
ccacccccagtgtccccagttgttctcatccaaggtgctattcgagtccagcctgaggga
ctgaccccccctgctccacggcctgagaggaagagcattgttccagctcctatgcctggg
aactcctgcccgcctgaggtggatgcaaagttgctgaagcggcagcagcgaatgatcaag
aaccgggagtcggcctgccagtcccggaggaagaagaaagagtatctgcaggggctggaa
gctcggctgcaggctgtgctggccgacaaccagcagctccggcgggagaatgctgccctc
cgccggcggctggaggccctgctggctgagaacagcgagctcaagttagggtctggaaac
aggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtc
agcatcagtgagcctcctccagctcccatctctcctcggatgagcagagaggagcctcga
ccccagagacacttgctggagttctcggcgcaagagccagttcacagagtcgagcacccc
cagcatccctcccagggtcccaaggagacccagcccagctccacgggccagccaagtttc
aggaacctgacagccttccctgggggcaccaaggagctgctgctgagagacctggaccag
ctcttcctctcctctgattgccggcacttcaacaggaccgagtccctgaggcttgctgat
gagctgagtggctgggtccagcgccaccagagaggccggcggaagatgccccagaggccc
caggagagacagaagtctcagctatggaagaagtcgcctccagttaaggcagtccccacc
caaccccctgggcccccagaaagggatgctgtgggccagctgcagctatatcgccaacca
gaccgttcacagccagagttcctggatgcaattgaccgacgggaagacacattttatgtt
gtctccttccgaagggaccacttgctgctcccagccatcagccacaacaagacctctcgg
cccaagatgtccctggtgatgcccgccatggcccccaatgagaccctgtcaggccggggg
cccccgggagactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtg
atccacatcaagacctccacggtgcccccctcactccgaaaacagccgtcctcaagcccg
ggcaatgccaccggtggccccttgccagcttctgaagccagccaggcccaccaggccgcc
cgtcagccctctacctcaatcatccctgacctctacgactcacactga

DBGET integrated database retrieval system