KEGG   Orcinus orca (killer whale): 101273830
Entry
101273830         CDS       T05247                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04144  Endocytosis
oor04150  mTOR signaling pathway
oor04270  Vascular smooth muscle contraction
oor04310  Wnt signaling pathway
oor04350  TGF-beta signaling pathway
oor04360  Axon guidance
oor04510  Focal adhesion
oor04520  Adherens junction
oor04530  Tight junction
oor04611  Platelet activation
oor04621  NOD-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04660  T cell receptor signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04810  Regulation of actin cytoskeleton
oor04921  Oxytocin signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04972  Pancreatic secretion
oor05100  Bacterial invasion of epithelial cells
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05152  Tuberculosis
oor05163  Human cytomegalovirus infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101273830 (RHOA)
   04015 Rap1 signaling pathway
    101273830 (RHOA)
   04310 Wnt signaling pathway
    101273830 (RHOA)
   04350 TGF-beta signaling pathway
    101273830 (RHOA)
   04072 Phospholipase D signaling pathway
    101273830 (RHOA)
   04071 Sphingolipid signaling pathway
    101273830 (RHOA)
   04024 cAMP signaling pathway
    101273830 (RHOA)
   04022 cGMP-PKG signaling pathway
    101273830 (RHOA)
   04150 mTOR signaling pathway
    101273830 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101273830 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101273830 (RHOA)
   04520 Adherens junction
    101273830 (RHOA)
   04530 Tight junction
    101273830 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101273830 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101273830 (RHOA)
   04621 NOD-like receptor signaling pathway
    101273830 (RHOA)
   04625 C-type lectin receptor signaling pathway
    101273830 (RHOA)
   04660 T cell receptor signaling pathway
    101273830 (RHOA)
   04670 Leukocyte transendothelial migration
    101273830 (RHOA)
   04062 Chemokine signaling pathway
    101273830 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101273830 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    101273830 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101273830 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    101273830 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101273830 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    101273830 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101273830 (RHOA)
   05206 MicroRNAs in cancer
    101273830 (RHOA)
   05205 Proteoglycans in cancer
    101273830 (RHOA)
   05203 Viral carcinogenesis
    101273830 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101273830 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101273830 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101273830 (RHOA)
   05135 Yersinia infection
    101273830 (RHOA)
   05133 Pertussis
    101273830 (RHOA)
   05152 Tuberculosis
    101273830 (RHOA)
   05100 Bacterial invasion of epithelial cells
    101273830 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101273830 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101273830 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101273830 (RHOA)
   04031 GTP-binding proteins [BR:oor04031]
    101273830 (RHOA)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    101273830 (RHOA)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101273830 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   101273830 (RHOA)
  Exosomal proteins of colorectal cancer cells
   101273830 (RHOA)
  Exosomal proteins of bladder cancer cells
   101273830 (RHOA)
GTP-binding proteins [BR:oor04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    101273830 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 101273830
NCBI-ProteinID: XP_004283988
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc
ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtacctacagtgtttgag
aactatgtggcagatattgaagtggacggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcctctctcctacccggatactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtgaaa
ccggaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system