KEGG   Orcinus orca (killer whale): 101274113Help
Entry
101274113         CDS       T05247                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04080  Neuroactive ligand-receptor interaction
oor04972  Pancreatic secretion
oor04974  Protein digestion and absorption
oor05164  Influenza A
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101274113
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101274113
   04974 Protein digestion and absorption
    101274113
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101274113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oor01002]
    101274113
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101274113
Enzymes [BR:oor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101274113
Peptidases [BR:oor01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101274113
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101274113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101274113
NCBI-ProteinID: XP_004272168
LinkDB All DBs
Position
Unknown
AA seq 245 aa AA seqDB search
MTTFIFLALLGVAVAFPTDDDKIVGGYTCEAHSIPYQVSLNSGYHFCGGSLISDQWVVSA
AHCYKSRMKVGLGAHNIEVLEGNEQFIKAAKIIVHPKFNKRTLDNDIMLIKLDPPATLNN
QVATIPLPTHCAAAGTQCLISGWGNTKSSGSNFPELLQCLKAPILSDSVCHSAYPEQISK
NMMCLGFLEGGKDSCQGDSGGPVVCKGQLQGIVSWGYGCALKGKPGVYTKVCNYVNWIQK
TIADN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccttcatttttcttgctctcttgggagtcgctgttgctttccccactgatgat
gacaagattgtcgggggctacacctgtgaagcgcattctatcccctaccaggtgtccctg
aactccggctaccacttctgtgggggctccctcatcagtgaccagtgggtggtgtccgcg
gctcactgctacaagtcccgaatgaaggtgggcctgggagcacacaacattgaagtcctt
gagggcaatgagcaattcatcaaagcagccaagatcatcgtccatcccaagttcaacaaa
aggaccttggataacgacatcatgctgattaaactggacccacctgccactctcaacaat
caagtagccactatccctctgccaacacattgtgcagctgctggtacccagtgtctcatc
tctggctggggcaacaccaagagcagtggctccaacttccctgagctcctgcagtgtctg
aaagctcccatcctgtctgacagcgtttgccacagtgcctatcccgaacagatctccaaa
aacatgatgtgcctgggcttcctggagggcggaaaggactcttgccagggtgactctggt
ggccctgtggtctgcaaaggacagctccagggcattgtctcctggggctatggctgcgct
ctgaaaggcaaacctggtgtctacactaaggtctgcaactatgtgaactggattcagaag
actatcgctgacaactaa

DBGET integrated database retrieval system