KEGG   Orcinus orca (killer whale): 101274382Help
Entry
101274382         CDS       T05247                                 

Gene name
NEU2
Definition
(RefSeq) LOW QUALITY PROTEIN: sialidase-2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00511  Other glycan degradation
oor00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101274382 (NEU2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101274382 (NEU2)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101274382 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2
Motif
Other DBs
NCBI-GeneID: 101274382
NCBI-ProteinID: XP_004262961
LinkDB All DBs
Position
Unknown
AA seq 379 aa AA seqDB search
MASCPILQRERVFQLGAHAYRIPALLYLPQQKTLLAFAEERTSEKDEHAKLIVLRKGSYN
ASTHQVRWHAQEAVAQAQMEGHRPMNPSPLYDEKTGTVFLFFIAVLGQVSEHHQLHTRVN
VTRLCQVTSTDHRRSWSPVRDIMDSVIGPAHKDXGTFAVGPGHCLQLHNPTQXLVLPAYT
YCTRPALQAPTPSAFCLVSHNHGNTWARGKFVAWDTLECQVAQVGDAKRRLVYLNARSPL
RARVQVQSANDGLDFGETQPVQKLVEPPHGCQGSIIGFPSPRAGSXIPDRXLLYTHPTDP
RGRANLGVYLNXQPPAPXAWSEPPLQTPGSCAYSDLQRMGAGPNGSPQFGCLYESDDYEE
IVFVMFTLKQVFPAEFLLQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctgccccatcctgcagagggagagagtgttccagttgggagcccatgcctac
aggatccccgctctgctctacctgcctcagcagaagaccctgctggcctttgcagaagag
cggacaagcgagaaggatgagcacgcgaagctaattgtcctgcgcaagggaagctacaac
gcgtccacccaccaggtccggtggcatgcacaggaggcggtggcccaagcccagatggag
ggccaccgccccatgaacccaagccccctgtacgacgagaagacagggaccgttttcctc
ttcttcattgccgtccttgggcaggtgtccgagcaccaccagcttcacaccagggtcaac
gtgacacggctgtgccaggtcaccagcaccgaccacaggaggtcctggagccccgtcagg
gacatcatggactctgtcattggcccggcccacaaggacnggggcactttcgcggtgggc
ccgggacactgtctccagctgcacaacccgacgcagnagctggtgctcccagcctacact
tactgcacccgtcccgccctgcaggcgcctaccccttccgccttctgcctggtcagccac
aaccacgggaacacgtgggcgagagggaaattcgtggcctgggacaccctggagtgccag
gtggcccaagttggggatgcaaaacggaggcttgtgtacctgaacgcgagaagccccctc
cgagccagggtccaggtccagagcgccaacgacgggctcgatttcggggagacccagcca
gtgcagaagctcgtggagcctccccacggctgccaagggagcatcattggcttccccagc
ccccgtgcgggatcangaatcccagaccggtgactgctctacacgcacccgactgaccca
cgggggagagccaacctgggcgtgtacctcaactgacagccccctgcaccctaggcctgg
tcggagccccccctgcagaccccgggcagctgcgcttactcagacctccagagaatgggc
gccggccccaatgggtcaccccagtttgggtgtctgtacgaatcggatgattacgaggag
atcgtctttgtcatgttcaccctgaaacaggtcttcccagctgaatttttgctgcagtga

DBGET integrated database retrieval system