KEGG   Orcinus orca (killer whale): 101274648
Entry
101274648         CDS       T05247                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04061  Viral protein interaction with cytokine and cytokine receptor
oor04151  PI3K-Akt signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  Jak-STAT signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04672  Intestinal immune network for IgA production
oor04940  Type I diabetes mellitus
oor05135  Yersinia infection
oor05142  Chagas disease (American trypanosomiasis)
oor05162  Measles
oor05166  Human T-cell leukemia virus 1 infection
oor05200  Pathways in cancer
oor05320  Autoimmune thyroid disease
oor05321  Inflammatory bowel disease (IBD)
oor05330  Allograft rejection
oor05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101274648 (IL2)
   04151 PI3K-Akt signaling pathway
    101274648 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101274648 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101274648 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101274648 (IL2)
   04660 T cell receptor signaling pathway
    101274648 (IL2)
   04658 Th1 and Th2 cell differentiation
    101274648 (IL2)
   04659 Th17 cell differentiation
    101274648 (IL2)
   04672 Intestinal immune network for IgA production
    101274648 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101274648 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101274648 (IL2)
   05321 Inflammatory bowel disease (IBD)
    101274648 (IL2)
   05330 Allograft rejection
    101274648 (IL2)
   05332 Graft-versus-host disease
    101274648 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101274648 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101274648 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101274648 (IL2)
   05162 Measles
    101274648 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    101274648 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101274648 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101274648 (IL2)
Cytokines and growth factors [BR:oor04052]
 Cytokines
  Interleukins
   101274648 (IL2)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Haparin
  Cytokines
   101274648 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 101274648
NCBI-ProteinID: XP_004265151
LinkDB
Position
Unknown
AA seq 154 aa
MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRML
TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS
ETRFTCEYDDETVTAVELLNKWITFCQSIYSTMT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttgtcttgcattgcactaactcttgcactcgtggcaaacggt
gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat
ttacatttgcttttgaaggaaattaataactatgagaacctcaagctcttcaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca
gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg
atagatatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct
gaaacaagattcacatgtgaatatgatgatgagacagtaaccgctgtagaacttctgaac
aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system