KEGG   Orcinus orca (killer whale): 101274967
Entry
101274967         CDS       T05247                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04140  Autophagy - animal
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04370  VEGF signaling pathway
oor04510  Focal adhesion
oor04722  Neurotrophin signaling pathway
oor04910  Insulin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor05010  Alzheimer disease
oor05014  Amyotrophic lateral sclerosis
oor05020  Prion disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05165  Human papillomavirus infection
oor05168  Herpes simplex virus 1 infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101274967 (BAD)
   04014 Ras signaling pathway
    101274967 (BAD)
   04370 VEGF signaling pathway
    101274967 (BAD)
   04024 cAMP signaling pathway
    101274967 (BAD)
   04022 cGMP-PKG signaling pathway
    101274967 (BAD)
   04151 PI3K-Akt signaling pathway
    101274967 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101274967 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    101274967 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101274967 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101274967 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101274967 (BAD)
   04919 Thyroid hormone signaling pathway
    101274967 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101274967 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101274967 (BAD)
   05203 Viral carcinogenesis
    101274967 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101274967 (BAD)
   05212 Pancreatic cancer
    101274967 (BAD)
   05225 Hepatocellular carcinoma
    101274967 (BAD)
   05221 Acute myeloid leukemia
    101274967 (BAD)
   05220 Chronic myeloid leukemia
    101274967 (BAD)
   05218 Melanoma
    101274967 (BAD)
   05211 Renal cell carcinoma
    101274967 (BAD)
   05215 Prostate cancer
    101274967 (BAD)
   05213 Endometrial cancer
    101274967 (BAD)
   05223 Non-small cell lung cancer
    101274967 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101274967 (BAD)
   05014 Amyotrophic lateral sclerosis
    101274967 (BAD)
   05020 Prion disease
    101274967 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    101274967 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101274967 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101274967 (BAD)
   05161 Hepatitis B
    101274967 (BAD)
   05160 Hepatitis C
    101274967 (BAD)
   05162 Measles
    101274967 (BAD)
   05168 Herpes simplex virus 1 infection
    101274967 (BAD)
   05165 Human papillomavirus infection
    101274967 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101274967 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101274967 (BAD)
   01524 Platinum drug resistance
    101274967 (BAD)
   01522 Endocrine resistance
    101274967 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 101274967
NCBI-ProteinID: XP_004264338
LinkDB
Position
Unknown
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHQQTAPGLLGEAGHQQGQPASSSH
HGGTGAVETRSRHSFYSAGTEDEEGTEEEEPSPFRGRSSSAPPNLWAAQRYGRELRRMSD
EFHGSFKGLPRPNSAGTAAQMRQSPSWTRFLQSWWNRNLGRGGPAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtcccagcaagcaccagcaaacg
gccccaggcctcctgggggaagctggtcaccagcaggggcagccagccagcagcagccac
catggaggcactggggctgtggagacccggagtcgccacagcttctactccgcggggacg
gaggatgaagaagggacggaggaggaggagcccagccccttccggggccgctcgagctcg
gcgccccccaacctctgggctgcacagcgatatggccgcgagctccggaggatgagcgac
gagttccacggctccttcaagggacttcctcgcccgaacagcgcgggcacagcggcgcag
atgcgacaaagccccagctggacgcgcttccttcagtcctggtggaaccggaacttgggg
agaggaggccccgccccctcccagtga

DBGET integrated database retrieval system