KEGG   Orcinus orca (killer whale): 101275089
Entry
101275089         CDS       T05247                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04137  Mitophagy - animal
oor04144  Endocytosis
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04510  Focal adhesion
oor04520  Adherens junction
oor04530  Tight junction
oor04540  Gap junction
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04625  C-type lectin receptor signaling pathway
oor04727  GABAergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05219  Bladder cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101275089 (SRC)
   04015 Rap1 signaling pathway
    101275089 (SRC)
   04370 VEGF signaling pathway
    101275089 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101275089 (SRC)
   04137 Mitophagy - animal
    101275089 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101275089 (SRC)
   04520 Adherens junction
    101275089 (SRC)
   04530 Tight junction
    101275089 (SRC)
   04540 Gap junction
    101275089 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101275089 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101275089 (SRC)
   04613 Neutrophil extracellular trap formation
    101275089 (SRC)
   04625 C-type lectin receptor signaling pathway
    101275089 (SRC)
   04062 Chemokine signaling pathway
    101275089 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101275089 (SRC)
   04915 Estrogen signaling pathway
    101275089 (SRC)
   04917 Prolactin signaling pathway
    101275089 (SRC)
   04921 Oxytocin signaling pathway
    101275089 (SRC)
   04926 Relaxin signaling pathway
    101275089 (SRC)
   04919 Thyroid hormone signaling pathway
    101275089 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    101275089 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101275089 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    101275089 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101275089 (SRC)
   05203 Viral carcinogenesis
    101275089 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    101275089 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101275089 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101275089 (SRC)
   05152 Tuberculosis
    101275089 (SRC)
   05100 Bacterial invasion of epithelial cells
    101275089 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101275089 (SRC)
   05168 Herpes simplex virus 1 infection
    101275089 (SRC)
   05163 Human cytomegalovirus infection
    101275089 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101275089 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101275089 (SRC)
   01522 Endocrine resistance
    101275089 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101275089 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101275089 (SRC)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101275089 (SRC)
Protein kinases [BR:oor01001]
 Non-receptor tyrosine kinases
  SRC family
   101275089 (SRC)
Membrane trafficking [BR:oor04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101275089 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101275089 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101275089 (SRC)
  Macropinocytosis
   Kinases
    101275089 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 101275089
NCBI-ProteinID: XP_004272874
LinkDB
Position
Unknown
AA seq 554 aa
MGSNKSKPKDASQRRRSLEPADNTHGGCGGGGGGGGGGGGGGGGGGGGAFPTSQTPSKPA
SADGHRGPSTAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETD
LSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESE
RLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCPMSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFG
EVWMGTWNGATRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTE
YMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLV
CKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKG
RVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDY
FTSTEPQYQPGENL
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggaacct
gctgataacacccatggcggctgtggcggcggcggcggcggcggcggcggcggcggcggc
ggcggcggcggcggcggcgggggtgccttccccacctcacagacccccagcaagccggcc
tccgctgatggccaccggggccccagcacggccttcgcccctgcagccgccgagcccaag
ctgttcggaggtttcaattcctccgacacagtcacctccccgcagagggcggggcccctg
gctggtggagtgaccacctttgtggccctctatgactatgagtcgcggacagagactgac
ctgtctttcaagaaaggggagcggctccaaattgtcaacaacacagagggagactggtgg
ctggcccactcactcagcacaggacagacgggctatatccccagcaactacgtcgcgccc
tccgactccatccaggccgaggagtggtactttggcaagatcaccagacgggagtcagag
cggttactgctcaatgcggagaacccaagagggaccttcctagtgcgagaaagtgagacc
acgaaaggcgcctactgcctctcagtgtctgacttcgacaacgccaagggcctcaacgtg
aagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgcacgcag
ttcaacagcctgcagcagctggtcgcctactactccaaacacgctgacggcctgtgccac
cgcctcaccactgtgtgccccatgtccaagccacagactcagggcctggccaaggacgcc
tgggagatcccccgggagtcgctgcggctggaggtcaagctgggccagggctgcttcgga
gaggtgtggatggggacctggaatggcgccaccagggtggccatcaaaactctgaagccc
ggcaccatgtctccggaggccttccttcaggaggcccaggtcatgaagaaactgaggcat
gagaagctggtgcagctgtacgcggtggtgtctgaggagcccatctacatcgtcacggag
tacatgagcaaggggagtttgctggactttctcaagggggagacgggcaagtacctgcgg
ctgcctcagctggtggacatggctgctcagatcgcttcaggcatggcgtacgtggagcgg
atgaactatgtccaccgagacctccgtgctgccaacatcctggttggagaaagcctcgtg
tgcaaagtggctgactttgggctggctcggctcatcgaagacaatgagtacacagcccgg
caaggtgccaagttccccatcaagtggacggctccagaagctgccctctatggccggttc
accatcaagtcagacgtgtggtccttcgggatcctgctgacagagctcacgacaaaggga
cgggtgccctaccccgggatggtgaaccgcgaggtgctggaccaggtggagaggggctac
cggatgccctgcccgcccgagtgtcccgagtctctgcatgacctcatgtgccagtgctgg
cggaaggacccagaggagcggcccaccttcgagtacctgcaggccttcctggaggactac
ttcacgtccaccgagccccagtaccagcccggagagaacctatag

DBGET integrated database retrieval system