KEGG   Orcinus orca (killer whale): 101275202
Entry
101275202         CDS       T05247                                 

Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04630  JAK-STAT signaling pathway
oor04640  Hematopoietic cell lineage
oor04664  Fc epsilon RI signaling pathway
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05221  Acute myeloid leukemia
oor05310  Asthma
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101275202
   04151 PI3K-Akt signaling pathway
    101275202
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101275202
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101275202
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101275202
   04664 Fc epsilon RI signaling pathway
    101275202
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101275202
   05202 Transcriptional misregulation in cancer
    101275202
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101275202
  09163 Immune disease
   05310 Asthma
    101275202
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101275202
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101275202
Cytokines and growth factors [BR:oor04052]
 Cytokines
  Interleukins
   101275202
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Haparin
  Cytokines
   101275202
SSDB
Motif
Pfam: IL3 BRICHOS
Other DBs
NCBI-GeneID: 101275202
NCBI-ProteinID: XP_012392201
LinkDB
Position
Unknown
AA seq 144 aa
MRSLPILHWLLFLLTLHTPQAQGAPLKTPGTQQCYVLNLIREIINELDKLPVASEDFLNS
NEKRRLMKTRLWTPNLEEFLTFATNSLGEDSKIKKNLKEIQPILPTTTSTEEPILIEKDN
LGDFRVKLKEYLSAIRDSLNCKNT
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcgcagcctccccatcctgcattggctcctgttcctgctcacactccacacccctcag
gcacaaggggcaccgctcaagacaccaggaacccaacaatgctatgtactcaacctgatc
cgggaaattataaatgagctagacaagctacctgtggcttcagaagacttcttgaactca
aacgaaaagaggaggctgatgaaaacaaggctctggacgccaaacctggaagaattcctg
acatttgccacaaattcccttggagaggattcgaaaatcaagaaaaatcttaaggaaatc
cagccaatcctgcccacaaccacgtccacggaagagccaatccttattgagaaggataac
ttgggtgatttccgggtgaaactgaaggaatatctgtctgccattagagactctctgaat
tgtaagaacacatag

DBGET integrated database retrieval system