KEGG   Orcinus orca (killer whale): 101275398
Entry
101275398         CDS       T05247                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04020  Calcium signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04072  Phospholipase D signaling pathway
oor04144  Endocytosis
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04520  Adherens junction
oor04540  Gap junction
oor04630  JAK-STAT signaling pathway
oor04810  Regulation of actin cytoskeleton
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor05160  Hepatitis C
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101275398 (EGFR)
   04012 ErbB signaling pathway
    101275398 (EGFR)
   04014 Ras signaling pathway
    101275398 (EGFR)
   04015 Rap1 signaling pathway
    101275398 (EGFR)
   04630 JAK-STAT signaling pathway
    101275398 (EGFR)
   04066 HIF-1 signaling pathway
    101275398 (EGFR)
   04068 FoxO signaling pathway
    101275398 (EGFR)
   04020 Calcium signaling pathway
    101275398 (EGFR)
   04072 Phospholipase D signaling pathway
    101275398 (EGFR)
   04151 PI3K-Akt signaling pathway
    101275398 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101275398 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101275398 (EGFR)
   04520 Adherens junction
    101275398 (EGFR)
   04540 Gap junction
    101275398 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101275398 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101275398 (EGFR)
   04915 Estrogen signaling pathway
    101275398 (EGFR)
   04921 Oxytocin signaling pathway
    101275398 (EGFR)
   04926 Relaxin signaling pathway
    101275398 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    101275398 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101275398 (EGFR)
   05206 MicroRNAs in cancer
    101275398 (EGFR)
   05205 Proteoglycans in cancer
    101275398 (EGFR)
   05230 Central carbon metabolism in cancer
    101275398 (EGFR)
   05231 Choline metabolism in cancer
    101275398 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101275398 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101275398 (EGFR)
   05212 Pancreatic cancer
    101275398 (EGFR)
   05225 Hepatocellular carcinoma
    101275398 (EGFR)
   05226 Gastric cancer
    101275398 (EGFR)
   05214 Glioma
    101275398 (EGFR)
   05218 Melanoma
    101275398 (EGFR)
   05219 Bladder cancer
    101275398 (EGFR)
   05215 Prostate cancer
    101275398 (EGFR)
   05213 Endometrial cancer
    101275398 (EGFR)
   05224 Breast cancer
    101275398 (EGFR)
   05223 Non-small cell lung cancer
    101275398 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101275398 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101275398 (EGFR)
   05171 Coronavirus disease - COVID-19
    101275398 (EGFR)
   05163 Human cytomegalovirus infection
    101275398 (EGFR)
   05165 Human papillomavirus infection
    101275398 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101275398 (EGFR)
   01522 Endocrine resistance
    101275398 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101275398 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101275398 (EGFR)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101275398 (EGFR)
Protein kinases [BR:oor01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101275398 (EGFR)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101275398 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   101275398 (EGFR)
  Exosomal proteins of bladder cancer cells
   101275398 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 101275398
NCBI-ProteinID: XP_004283056
LinkDB
Position
Unknown
AA seq 1209 aa
MRRSEAGRAVLLALLAAHFQASPALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVETIPLEKLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPVLCNMDTVQWRDIVNADFLSNMSIEF
QSQLSRCPKCDPACLNGSCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCHSQCAAGC
TGPRESDCLVCRRFRDGATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVRKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFKGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPANRTGLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRKLCYADTINWKKL
FGTSSQKTKITNNRSEKECKAMGHVCNPLCSSEGCWGPKPEDCMSCRNFSRGRECVEKCN
ILKGEPREFVENSECVQCHPECLPQAMNVTCTGHGPGSCVKCAHNIDGPHCVKTCPAGVT
GENSTLIWKFADANHVCHLCHPSCTYGCAGPGSEGCAVSGPRIPSIATGMVGALLLALVL
ALGVGLFLRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETELKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMQDVVDADEYLIPQ
QGFFHSPASSRTPLLSSLSSTSNTPTVACGDRNGQSYPLQEDSFLQRYSSDPTGTLTEDS
IDDAFLPAPEYVNQSIPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNSHSNAVDSPEYLNT
THPACTNGVLDGPALWAQKGGHQINLDNPDYQQAFLPKEAKSNGIFKGSAAENAEYLRVA
PAGSDLTGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacgctccgaagcgggccgcgccgtgctcctggcgctgctggccgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ttgggcacttttgaagaccactttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacatgcaaagtagttacaacctttctttcctaaag
accatccaggaggttgctggctatgtactcattgccctcaacacagtggagacgattcct
ttggaaaagctgcagatcatcagaggaaatgtgctctatgaaaacacccatgccttagcg
gtcttatccaactacggtgcaaataaaacgggactgagggagttgcccatgagaaactta
caggagatcctgcaaggcgccgtgcgattcagcaacaaccctgtcctctgcaacatggac
accgtccagtggagggacatcgtcaacgccgactttctaagcaatatgtcgattgaattt
cagagccagctgagcagatgcccaaagtgtgatccagcctgtcttaatggaagctgctgg
ggtgcagggaaggagaactgccagaaactgaccaaagtcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagcgactgctgccacagccagtgtgccgccggctgc
acggggccgcgggagagtgactgcctggtctgccgcaggttccgggacggagccacgtgc
aaggacacatgcccgccactcatgctgtacgaccccaccacctacgagatgaaagtcaac
ccgctggggaagtacagcttcggcgccacctgtgtcaggaagtgtccccgtaactacgtg
gtgacggaccacggctcgtgcgtccgcgcctgcagctctgacagccaggaggtggaggag
gacggcgtccgcaagtgtaaaaagtgtgacggaccttgtggcaaagtttgtaacggaata
ggaattggtgagtttaaagatacactttccataaatgctacaaatattaaacacttcaga
aattgcacctcgatcagtggagaccttcatatcctgccagtagcatttaagggtgattcc
ttcacacgtactccacctctggacccaaaggaactggacattctaaaaactgtaaaggaa
ataacagggtttttgctgattcaggcctggcctgcaaacaggactggcctccatgctttt
gagaacctggaaatcatacgtggcaggacgaagcaacatggtcagttttctctggcggtt
gttggcctggatataacgtccttgggattacgctccctcaaggagataagtgatggagat
gtgatcatttcaggaaaccgaaagttgtgctacgcagatacaataaactggaaaaaactc
tttgggacctcaagtcagaaaaccaaaattaccaacaacaggagtgaaaaagagtgcaag
gccatgggccacgtctgtaacccgctgtgttcgtcagagggctgctggggcccgaaaccc
gaagactgcatgtcctgccgaaacttcagccgtggcagggagtgtgtggagaagtgcaac
attctaaaaggagagcccagggagttcgttgaaaactccgagtgcgtgcagtgccatccg
gaatgcctgccccaggccatgaacgtgacctgcacgggacacggaccaggcagctgtgta
aagtgtgcccacaacatcgacggccctcactgcgtcaagacctgccctgctggagtcaca
ggagaaaacagcaccctgatctggaagtttgcagatgccaatcacgtgtgtcacctgtgc
caccccagctgcacctacggctgtgctgggcccggttctgaaggctgtgcagtgagtggg
cccaggattccgtccatcgccaccgggatggtgggcgccctgctgctggccctggtgctg
gccctgggggtcggcctctttctgcgcaggcgccgcatcgtccgcaagcgcacgctgcgc
cggctgctgcaggagcgcgagcttgtcgagcctctgacgcccagcggagaagctcccaac
caagctctcttgaggatcttaaaggagacggaattaaaaaaggtcaaggtgctgggctcc
ggagcattcggcacggtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtggctatcaaggaattaagagaagccacatctccaaaagccaacaaggagattctt
gatgaagcctacgtgatggccagtgtggacaatccgcacgtgtgccgcctcctgggcatc
tgcctgacgtccacggtgcagctcatcacgcagctcatgcccttcggctgcctgctggac
tacgtccgcgagcacaaggacaacatcggttcccagcacctgctcaactggtgcgtgcag
atcgcaaagggcatgaactacctggaagaccggcgcctggtgcaccgagacctggcggcc
aggaatgtgctggtgaagacgccgcagcacgtcaagatcacggatttcggcctggccaaa
ctgctcggcgccgaggagaaagaataccacgcggaggggggcaaggtgcctatcaagtgg
atggctttggaatcaattctacaccgaatttatacccaccagagtgacgtctggagctac
ggagtcaccgtttgggagttgatgacctttgggtccaagccttacgacgggatccccgcg
agtgagatctcaaccgtcctggagaagggagaacgcctgcctcagccgcccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgattgatgcagatagtcgcccgaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtc
atccagggggacgagaggatgcatttgccaagccccacggactccaacttctaccgcgcc
ctgatggacgaagaggacatgcaagatgtcgtggatgcggacgagtacctcatcccccag
cagggcttcttccacagccccgccagctcccggacgcccctcctcagttctctgagctcc
accagcaacacgcccactgtggcttgcggtgatagaaacgggcagagctatcccctccag
gaagatagcttcttgcagcggtacagctcagaccccactggcaccttgaccgaggacagc
atagatgacgccttccttccagcacccgaatacgtaaaccagtctattcccaaaaggccc
gcgggctctgtccagaaccccgtctatcacaatcagcctctaaacccggctccaggcaga
gaccctcactaccagaattcccacagcaatgccgtggacagccctgagtatctcaacacc
acccatcccgcctgcaccaacggtgtgctcgacggccctgccctctgggcacagaaaggt
ggtcaccaaattaacctggacaaccctgactaccagcaggccttccttcccaaggaagcc
aagtcaaatggcatctttaagggttctgccgctgaaaatgcagaatacctaagggtagca
ccagcgggcagcgaccttaccggggcctga

DBGET integrated database retrieval system