KEGG   Orcinus orca (killer whale): 101275490
Entry
101275490         CDS       T05247                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04062  Chemokine signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04510  Focal adhesion
oor04670  Leukocyte transendothelial migration
oor04810  Regulation of actin cytoskeleton
oor04935  Growth hormone synthesis, secretion and action
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05146  Amoebiasis
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05205  Proteoglycans in cancer
oor05222  Small cell lung cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101275490 (PTK2)
   04370 VEGF signaling pathway
    101275490 (PTK2)
   04151 PI3K-Akt signaling pathway
    101275490 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101275490 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101275490 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101275490 (PTK2)
   04062 Chemokine signaling pathway
    101275490 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101275490 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    101275490 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101275490 (PTK2)
   05202 Transcriptional misregulation in cancer
    101275490 (PTK2)
   05205 Proteoglycans in cancer
    101275490 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101275490 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101275490 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101275490 (PTK2)
   05100 Bacterial invasion of epithelial cells
    101275490 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101275490 (PTK2)
   05163 Human cytomegalovirus infection
    101275490 (PTK2)
   05165 Human papillomavirus infection
    101275490 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101275490 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101275490 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101275490 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101275490 (PTK2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101275490 (PTK2)
Protein kinases [BR:oor01001]
 Non-receptor tyrosine kinases
  FAK family
   101275490 (PTK2)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101275490 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 Kinase-like
Other DBs
NCBI-GeneID: 101275490
NCBI-ProteinID: XP_012386845
LinkDB
Position
Unknown
AA seq 1075 aa
MAAAYLDPNLNHTPNSSTKTHLGTGVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVQEDALITFFFFFAFGLPQGLGQILSLVEI
LPSQDPQHRPVSGSPAPPSRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKA
KTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPE
EGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTLQLKIAGAPEPLTVTAPSLTIA
ENMADLIDGYCRLVHGATQSFIIRPQKEGERALPSIPKLANSEKQGVRTHAVSVSETDDY
AEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGAYTSPENPALAVAIKTCK
NCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYS
LDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYY
KASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIEN
GERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRR
QVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFHPSPQHMLQTNHYQVSGYPGSHGITAVA
GSIYPGQASLLDQTDSWNHRPQEISMWQPNVEDSATLDLRGIGQVLPTHLMEERLIRQQQ
EMEEDQRWLEKEERFLKPDVRLSRGSIDREDGGPQGPTGNQHIYQPVGKPDPAAPPKKPP
RPGAPGHLSSLASLGSPGDNYNEGVKLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIE
MSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGEL
INKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKALGQTRPH
NT seq 3228 nt   +upstreamnt  +downstreamnt
atggcagctgcctaccttgacccaaacttgaatcacacaccgaattcaagtaccaagact
cacctgggtaccggtgtggaacgttcccctggggccatggagcgagtgttgaaggtcttt
cattattttgaaagcaacagtgagccaaccacttgggccagtattatcaggcatggagac
gctactgacgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcacgtg
gcctgctatggatttcgcctcagtcacctgcggtcagaggaggttcactggctccatttg
gatatgggtgtctccaatgtgagggagaagtatgaacttgcacacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagac
aagccaactctgaatttcttctatcaacaggtacaggaggatgctttaataacatttttt
ttcttttttgcctttggtctacctcagggccttggacagattctttctttggtagaaatc
ctgccgtctcaggatccccagcaccgccccgtctcaggatccccagcaccgccctcaagg
cggtcgtactgggagatgcggggcaacgccctggagaagaagtctaactatgaagtatta
gaaaaagatgttggtttgaagcgattttttcctaggagtttactggactcagtcaaggcc
aaaacactaagaaaattgattcaacaaacatttagacagtttgccaaccttaatagagaa
gaaagtattttgaaattctttgagatcctctccccagtgtacagatttgataaagaatgc
ttcaagtgtgcccttggttcgagctggattatttcggtggagctggcgattggccccgaa
gaagggatcagttacctcacagacaagggctgcaaccccacacacctggccgacttcaat
caagtgcagaccattcagtattcaaacagcgaagacaaggacaggaaagggacgctgcag
ctgaagattgcaggagcgcctgagcctctgacggtgacagcaccgtccctgaccattgcc
gagaacatggccgacctgatagatgggtactgccggctggtgcacggggccacgcagtct
ttcatcatcaggcctcagaaagaaggtgaacgggctttgccatcaataccaaagctggcc
aacagcgagaagcagggtgttcggacccacgccgtctctgtgtcagaaacagatgactat
gctgagattatcgacgaggaagatacctacaccatgccctcgactagggactatgagatt
cagagagaaagaatagaactgggacggtgcatcggagagggccagttcggagacgtgcac
caaggcgcttacacgagcccggagaatccagctttggcggttgcaattaaaacatgtaaa
aactgtacttcggacagcgtgagagagaaattccttcaagaagccttaacaatgcgtcag
tttgaccaccctcacattgtgaagctgatcggagtcatcacagagaaccccgtctggatc
atcatggagctgtgcacgctcggagagctgaggtcatttctgcaagtaaggaaatacagt
ttggatctagcatctctgatcctctatgcctatcagcttagcacagcccttgcgtaccta
gagagcaaaagatttgtgcacagggacattgctgctcggaatgttctggtgtcctcaaac
gactgtgtaaaattaggagacttcggcttatcccgatacatggaagacagcacttactac
aaagcttccaaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgc
cgttttacctcagctagtgacgtatggatgtttggtgtgtgtatgtgggagatactgatg
cacggtgtgaagccctttcaaggcgtgaagaacaatgatgtgattggtcgcattgagaac
ggggagaggttgcccatgcctccaaactgccctcccaccctctacagcctcatgaccaag
tgctgggcctacgaccccagccggcggccccgcttcactgagctcaaagctcagctcagc
acaatcctggaggaagagaaggtccagcaagaagaacggatgaggatggagtccagaagg
caggtcacagtgtcctgggactctggagggtccgacgaagcaccacccaagcccagcaga
cctggttatcctagtccgaggtccagcgaagggtttcatcccagcccacagcacatgcta
cagaccaatcactaccaggtctctggctaccctggctcacatggaatcacagccgtggct
ggcagcatctacccaggtcaggcatctcttttggaccaaacggattcgtggaatcacaga
ccacaggagatatcgatgtggcagcccaacgtggaggactctgcaacactggacctgcgt
ggcatcgggcaggtgttgccgacccacctgatggaggagcggctgatccggcagcagcag
gagatggaagaggaccagcgctggctggagaaggaggagaggtttctgaaacctgacgtg
cggctctctcgaggcagcatcgacagggaggatggaggtcctcagggcccgactggaaac
cagcacatatatcagcctgtgggcaaaccagatcctgcagctccaccaaagaaaccaccg
cgtcccggagcccctgggcacctgagcagcctcgccagcctcggcagccccggggacaat
tacaacgagggtgtcaagcttcagccccaggaaatcagcccccctcccactgccaacctg
gaccggtccaatgacagggtgtacgagaacgtgacgggcctggtgagagcggtcatcgag
atgtccagcaagatccagccagccccgccagaggagtatgtccccatggtgaaggaagtc
ggcttggccctgaggacgctgttggccaccgtggatgagaccattcccgtcctgcccgcc
agcacccaccgagagattgagatggcccagaagctgctgaactccgacttgggggagctc
atcaacaagatgaagctggcccagcagtatgtcatgaccagcctgcagcaggagtacaag
aagcagatgctgacggccgcacacgccctggctgtggacgccaagaacctgctcgatgtc
atcgaccaggccagactgaaggccctggggcagacgaggccacactga

DBGET integrated database retrieval system