KEGG   Orcinus orca (killer whale): 101276413Help
Entry
101276413         CDS       T05247                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega-2 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00480  Glutathione metabolism
oor00980  Metabolism of xenobiotics by cytochrome P450
oor00982  Drug metabolism - cytochrome P450
oor00983  Drug metabolism - other enzymes
oor01100  Metabolic pathways
oor01524  Platinum drug resistance
oor05200  Pathways in cancer
oor05204  Chemical carcinogenesis
oor05225  Hepatocellular carcinoma
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101276413 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101276413 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    101276413 (GSTO2)
   00983 Drug metabolism - other enzymes
    101276413 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101276413 (GSTO2)
   05204 Chemical carcinogenesis
    101276413 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101276413 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101276413 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101276413 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oor02000]
    101276413 (GSTO2)
Enzymes [BR:oor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101276413 (GSTO2)
Transporters [BR:oor02000]
 Other transporters
  Pores ion channels [TC:1]
   101276413 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 101276413
NCBI-ProteinID: XP_004265921
LinkDB All DBs
Position
Unknown
AA seq 244 aa AA seqDB search
MTDDAARTLGRGSAPPGPVPEGLIRLYSMRFCPYAHRTRLVLQAKGIRHEVININLRNKP
EWYFTKHPFGKIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPCDSYERARQKMLLDLF
YKVPHLTKECLIASRCGRECADLKLALRQEFCNLEEILGYQNTVFFGGDCISMIDYLFWP
WFERLDVYGIADCVNHTPALRLWIAAMKQDPTVCALLIDKNIFLGFLNLYFQNNPDAFDY
GLSC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgatgcggccaggaccttggggagagggagcgcccccccagggcctgtccca
gagggcctgatccgcctctacagcatgaggttctgcccctatgcgcacaggacgcgcctg
gtcctccaggccaaaggcatcagacatgaagttatcaacattaacctgagaaacaagcct
gaatggtactttacaaagcacccttttggcaaaattcctgtcctggagaacagcaaatgt
caactgatctatgaatctgtcattgcttgtgagtacctggatgacgcttatcctggaagg
aagctgtatccatgtgactcttatgagcgagctcgccaaaagatgttattggacctattc
tataaggtcccacatttgaccaaggagtgtctgatagcatcgagatgtgggagagaatgc
gctgatctgaagctagccctgcgtcaggagttctgcaacctggaagagattcttggctat
cagaacacagtcttcttcggtggtgactgtatatccatgattgattacctcttttggcct
tggtttgagcggctggatgtatatggaatagctgactgtgtgaaccacacccccgcgctc
cggctctggatcgcagccatgaagcaggaccccacagtatgtgctcttctcatagataag
aacatcttcctcggcttcttgaatctctattttcagaacaaccccgatgcctttgactat
gggctaagttgctga

DBGET integrated database retrieval system