KEGG   Orcinus orca (killer whale): 101276416Help
Entry
101276416         CDS       T05247                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8 isoform X1
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor05034  Alcoholism
oor05165  Human papillomavirus infection
oor05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    101276416 (HDAC8)
  09165 Substance dependence
   05034 Alcoholism
    101276416 (HDAC8)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    101276416 (HDAC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101276416 (HDAC8)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101276416 (HDAC8)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101276416 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101276416
NCBI-ProteinID: XP_004285594
LinkDB All DBs
Position
Unknown
AA seq 415 aa AA seqDB search
MLTREHRCGRSEEQEPEPGLSPKKAGSGRWLRNGCKWKMEEPEEPADGGQSLPPVYIYSP
EYVSMCDSLAKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVAINWSGGWH
HAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHK
FSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYIAFNPKAVVL
QLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRVQQILNYIKGNLKHVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagggagcaccgctgcggccgatcagaggagcaggaaccggagcccgggctg
agtccgaaaaaagccggatccggacggtggctccggaacggctgtaagtggaagatggag
gagccggaggaaccggcggacggtgggcagtcgctgcccccggtttacatttacagcccc
gagtatgttagcatgtgcgactccctggccaaagtccccaaacgggccagtatggtacat
tccttgattgaagcatatgcactgcataagcaaatgaggatagttaagcccaaagtggcc
tccatggaggagatggccactttccacaccgatgcctatctgcagcatctccagaaggtc
agccaggaaggagatgatgatcatccagactccatagaatatggactaggttatgactgc
ccagccactgaaggaatatttgactatgcagcagctgtaggaggggctacaatcacagct
gcccagtgcctgattgatggaatgtgcaaagtagcgatcaactggtctggagggtggcat
catgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctgggaata
ttacgattacgacggaaatttgaccgtattctctatgtggatttggatctgcaccacgga
gatggtgtagaagatgccttcagtttcacctccaaagtcatgacggtgtccctgcacaaa
ttctccccaggatttttcccaggaacaggtgatgtgtctgatgtcggcctagggaaggga
cggtactacagtgtaaatgtgcccattcaggatggcatacaggatgagaagtattaccac
atctgcgaaagtgtactaaaggaggtgtacatagcctttaatcccaaagcagtggtctta
cagctgggagctgatacaatagctggggatcccatgtgctcctttaacatgactccagtg
ggaattggcaagtgtcttaagtacatccttcagtggcaattggcaacgctcattttggga
ggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggggtcatc
ctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatatggtcct
gattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccccaccgagtc
cagcaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system