Orcinus orca (killer whale): 101276750 Help Entry 101276750         CDS       T05247                                  Gene name BCL2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism oor  Orcinus orca (killer whale) Pathway oor01521   EGFR tyrosine kinase inhibitor resistance oor01522   Endocrine resistance oor01524   Platinum drug resistance oor04064   NF-kappa B signaling pathway oor04066   HIF-1 signaling pathway oor04071   Sphingolipid signaling pathway oor04115   p53 signaling pathway oor04140   Autophagy - animal oor04141   Protein processing in endoplasmic reticulum oor04151   PI3K-Akt signaling pathway oor04210   Apoptosis oor04215   Apoptosis - multiple species oor04217   Necroptosis oor04261   Adrenergic signaling in cardiomyocytes oor04340   Hedgehog signaling pathway oor04510   Focal adhesion oor04621   NOD-like receptor signaling pathway oor04630   JAK-STAT signaling pathway oor04722   Neurotrophin signaling pathway oor04725   Cholinergic synapse oor04915   Estrogen signaling pathway oor04928   Parathyroid hormone synthesis, secretion and action oor04933   AGE-RAGE signaling pathway in diabetic complications oor05014   Amyotrophic lateral sclerosis oor05022   Pathways of neurodegeneration - multiple diseases oor05132   Salmonella infection oor05145   Toxoplasmosis oor05152   Tuberculosis oor05161   Hepatitis B oor05162   Measles oor05168   Herpes simplex virus 1 infection oor05169   Epstein-Barr virus infection oor05170   Human immunodeficiency virus 1 infection oor05200   Pathways in cancer oor05206   MicroRNAs in cancer oor05210   Colorectal cancer oor05215   Prostate cancer oor05222   Small cell lung cancer oor05226   Gastric cancer oor05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oor00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101276750 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     101276750 (BCL2)    04630 JAK-STAT signaling pathway     101276750 (BCL2)    04064 NF-kappa B signaling pathway     101276750 (BCL2)    04066 HIF-1 signaling pathway     101276750 (BCL2)    04071 Sphingolipid signaling pathway     101276750 (BCL2)    04151 PI3K-Akt signaling pathway     101276750 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101276750 (BCL2)   09143 Cell growth and death    04210 Apoptosis     101276750 (BCL2)    04215 Apoptosis - multiple species     101276750 (BCL2)    04217 Necroptosis     101276750 (BCL2)    04115 p53 signaling pathway     101276750 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101276750 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101276750 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     101276750 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     101276750 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101276750 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     101276750 (BCL2)    04722 Neurotrophin signaling pathway     101276750 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101276750 (BCL2)    05206 MicroRNAs in cancer     101276750 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     101276750 (BCL2)    05226 Gastric cancer     101276750 (BCL2)    05215 Prostate cancer     101276750 (BCL2)    05222 Small cell lung cancer     101276750 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101276750 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     101276750 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101276750 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101276750 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     101276750 (BCL2)    05152 Tuberculosis     101276750 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101276750 (BCL2)    05161 Hepatitis B     101276750 (BCL2)    05162 Measles     101276750 (BCL2)    05168 Herpes simplex virus 1 infection     101276750 (BCL2)    05169 Epstein-Barr virus infection     101276750 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101276750 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101276750 (BCL2)    01524 Platinum drug resistance     101276750 (BCL2)    01522 Endocrine resistance     101276750 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oor01009]     101276750 (BCL2) Protein phosphatases and associated proteins [BR:oor01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101276750 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  101276750 NCBI-ProteinID:  XP_004268115 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGATSPGAAPAPGIFSSQTGSTPAPS RTSPPPPQTAPAAPAGGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH TWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccacgtccccg ggggccgcccccgcgccgggcatcttctcctcccagactgggagcaccccagcgccatcc aggacctccccgccgccgccccagaccgctcccgccgcccccgccggggggcctgcgctc agccccgtgccacctgtggtccacctgaccctgcgccaggccggtgatgatttttctcgt cgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcg aggggacgctttgccacggtggtggaggagctcttcagggatggagtgaactgggggagg atcgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatg tcccccctggtggacaacatcgccctgtggatgactgagtacctgaaccgacacctgcac acctggatccaggataacggaggctgggatgcctttgtggagctgtacggccccagcatg cggcctctgtttgatttctcctggctgtctctgaaggcactgctcagtctggccctggtg ggagcttgcatcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system