KEGG   Orcinus orca (killer whale): 101276750
Entry
101276750         CDS       T05247                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04064  NF-kappa B signaling pathway
oor04066  HIF-1 signaling pathway
oor04071  Sphingolipid signaling pathway
oor04115  p53 signaling pathway
oor04140  Autophagy - animal
oor04141  Protein processing in endoplasmic reticulum
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04215  Apoptosis - multiple species
oor04217  Necroptosis
oor04261  Adrenergic signaling in cardiomyocytes
oor04340  Hedgehog signaling pathway
oor04510  Focal adhesion
oor04621  NOD-like receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04915  Estrogen signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05014  Amyotrophic lateral sclerosis
oor05022  Pathways of neurodegeneration - multiple diseases
oor05132  Salmonella infection
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05162  Measles
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05215  Prostate cancer
oor05222  Small cell lung cancer
oor05226  Gastric cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101276750 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101276750 (BCL2)
   04630 JAK-STAT signaling pathway
    101276750 (BCL2)
   04064 NF-kappa B signaling pathway
    101276750 (BCL2)
   04066 HIF-1 signaling pathway
    101276750 (BCL2)
   04071 Sphingolipid signaling pathway
    101276750 (BCL2)
   04151 PI3K-Akt signaling pathway
    101276750 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101276750 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    101276750 (BCL2)
   04215 Apoptosis - multiple species
    101276750 (BCL2)
   04217 Necroptosis
    101276750 (BCL2)
   04115 p53 signaling pathway
    101276750 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101276750 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101276750 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101276750 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    101276750 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101276750 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    101276750 (BCL2)
   04722 Neurotrophin signaling pathway
    101276750 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101276750 (BCL2)
   05206 MicroRNAs in cancer
    101276750 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101276750 (BCL2)
   05226 Gastric cancer
    101276750 (BCL2)
   05215 Prostate cancer
    101276750 (BCL2)
   05222 Small cell lung cancer
    101276750 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101276750 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    101276750 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101276750 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101276750 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101276750 (BCL2)
   05152 Tuberculosis
    101276750 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101276750 (BCL2)
   05161 Hepatitis B
    101276750 (BCL2)
   05162 Measles
    101276750 (BCL2)
   05168 Herpes simplex virus 1 infection
    101276750 (BCL2)
   05169 Epstein-Barr virus infection
    101276750 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101276750 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101276750 (BCL2)
   01524 Platinum drug resistance
    101276750 (BCL2)
   01522 Endocrine resistance
    101276750 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101276750 (BCL2)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101276750 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101276750
NCBI-ProteinID: XP_004268115
LinkDB
Position
Unknown
AA seq 233 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGATSPGAAPAPGIFSSQTGSTPAPS
RTSPPPPQTAPAAPAGGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA
RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH
TWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccacgtccccg
ggggccgcccccgcgccgggcatcttctcctcccagactgggagcaccccagcgccatcc
aggacctccccgccgccgccccagaccgctcccgccgcccccgccggggggcctgcgctc
agccccgtgccacctgtggtccacctgaccctgcgccaggccggtgatgatttttctcgt
cgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcg
aggggacgctttgccacggtggtggaggagctcttcagggatggagtgaactgggggagg
atcgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatg
tcccccctggtggacaacatcgccctgtggatgactgagtacctgaaccgacacctgcac
acctggatccaggataacggaggctgggatgcctttgtggagctgtacggccccagcatg
cggcctctgtttgatttctcctggctgtctctgaaggcactgctcagtctggccctggtg
ggagcttgcatcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system