KEGG   Orcinus orca (killer whale): 101276871
Entry
101276871         CDS       T05247                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101276871 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oor03000]
    101276871 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:oor03310]
    101276871 (NR3C1)
Transcription factors [BR:oor03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101276871 (NR3C1)
Nuclear receptors [BR:oor03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101276871 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 101276871
NCBI-ProteinID: XP_004280264
LinkDB
Position
Unknown
AA seq 781 aa
MDPKESLSPPSREEIPSSVLSRERGNVMDFYKTLRGGATVKVSASSPSLAAASQADSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQMSLSSGETDF
RLLEESIANLNRSTSVPENPKNSASAAASAAPTEKEFPKTHSDVSSEQQNLKGQTGTNGG
NVKLYTTDQSTFDIWRKKLQDLEFSSGSPGKETSESPWSSDLLIDENCLLSPLAGEDDPF
LLEGNSKEDCKPLVLPDTKPKIKDNGDLILSSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC
RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLL
EVIEPEVIYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLL
QYSWMFLMSFALGWRSYRQSSSNLLCFAPDLIINEQRMALPCMYDQCKHMLYVSSELNRL
QVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFY
QLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQ
K
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcattaagcccccccagtagagaagaaatccccagcagtgtgctt
agtcgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttcaccctcactggctgctgcttctcaggctgactccaagcagcaa
agacttttggttgattttccaaaaggctccggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactctcaatgggactgtatatgggagagacagagacaaaagtaatggga
aatgacctgggattcccacagcagggccaaatgagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagaattcagcatcagctgctgcctctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtatcttcagaacagcaaaatttgaagggccagactggcactaatgggggt
aatgtgaagttgtataccacagaccaaagcacctttgacatatggaggaaaaaactccag
gatttggagttttcttctgggtccccaggtaaagagacaagtgagagcccttggagctca
gacctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattc
cttctggaaggaaactcaaaagaggactgtaagcctcttgtcttaccggacactaaacct
aaaattaaggataatggagatctgatcttatcaagccctaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagattttattgaactctgcacccctggagtaattaagcaggag
aaactgggcccagtttattgtcaggccagcttttctggagcaaatataattggtaataaa
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgac
atgaatacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaatagatgccagggatctggagatgataacttg
acttccttagggactttgaacttctccggtcgatcggttttttctaatggctattcaagc
cctggaatgagaccagatgtaagctctcctccatccagctcctcagcagcaacgggacca
cctcccaaactctgcctagtgtgctctgatgaagcttcgggatgtcattatggggtctta
acttgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattatctt
tgtgctggaagaaatgattgcatcattgataaaattcgaagaaaaaactgcccagcatgc
cgctatagaaaatgtcttcaagcaggaatgaacctggaagctcgtaaaacaaagaaaaag
ataaaaggaattcagcaggccactacaggagtctcacaagaaacttctgaaaattctgct
aacaaaacaatagtccccgcaacgttaccgcaactcacccctaccctggtgtcactgctg
gaggtcattgagccggaggtgatatatgcgggctacgacagctccattccagatacaact
tggcggatcatgactacactcaacatgttaggtgggcggcaggtgatcgcagcggtgaaa
tgggcgaaggcgataccaggattcaggaacttacatctggatgaccaaatgaccctactg
cagtattcatggatgttcctcatgtcattcgccctggggtggagatcatacagacaatca
agttccaacttgctgtgttttgctcctgatctgattattaatgagcagagaatggcttta
ccctgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaaacagactt
caggtatcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagttcct
aaggaaggtttgaagagtcaagagctatttgatgaaattagaatgacctacatcaaagag
ctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttttac
caactgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaactattgc
ttccaaacatttttggataagaccatgagtattgaattcccagagatgttagctgaaatc
atcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaa
aagtga

DBGET integrated database retrieval system