KEGG   Orcinus orca (killer whale): 101277066
Entry
101277066         CDS       T05247                                 

Gene name
PPP1R12C
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12C isoform X1
  KO
K17457  protein phosphatase 1 regulatory subunit 12C
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04270  Vascular smooth muscle contraction
oor04510  Focal adhesion
oor04810  Regulation of actin cytoskeleton
oor04921  Oxytocin signaling pathway
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101277066 (PPP1R12C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101277066 (PPP1R12C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101277066 (PPP1R12C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101277066 (PPP1R12C)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101277066 (PPP1R12C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101277066 (PPP1R12C)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101277066 (PPP1R12C)
SSDB
Motif
Pfam: PRKG1_interact Ank_2 Ank_4 Ank_5 Ank_3 Ank DUF4695
Other DBs
NCBI-GeneID: 101277066
NCBI-ProteinID: XP_004283355
LinkDB
Position
Unknown
AA seq 782 aa
MSGEDGPGAGSGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACA
GGDLDEARLMLRAADPGPGAELDPADPPPARAVLDSTNADGISALHQACIDENLEVVRFL
VEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAME
GLLKVEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYI
EVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLA
DEEVLSLLEELARKQEDLRNQKEASQSRGQEPQGPSSSKHRRSSVCRLSSREKISLQDLS
KERRPGGAGGPPIRDEDEGEEGPSEPPPAESRTLNGVSSPPPSSPRSPMTPDEAPFSTRF
GLQKTGSSGALGPAERRGAEGASGAGLQRSASSSRLEGTYTQAREPRLARITPTPSRKVP
ESSAPSEISRPPPPLGNSTPASRVPEPESPVKPNVPVASAAPPADSRDRRRSYQMPVRDE
ESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPEPEKSCLQSLDPSRRPRVPGV
ENSDGPAQRAEAPDGQGQGPQAAEEHRRVSKEWRGPAEGEEAEPAPADRSPGSSTPEGGP
SSRRQRDLNPEPEPEPEEPDGGFRKLYAELRSENERLREALTETTLQLAQLKVELERATQ
RQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKL
SK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtcgggcgaggatggcccgggggcgggctccggggcggcggcggcagcggcccgcgag
cggcggcgggagcagctgcggcagtggggggcgcgggcgggcgccgaaccgggccccggg
gagcggcgcgcccgcaccgtgcgcttcgagcgcgccgccgagttcctggcggcctgcgcg
ggcggcgatctggacgaggcgcgcctgatgctgcgcgcggccgaccccggcccgggcgcc
gagctcgaccctgctgacccgccgcccgcccgcgcagtgctggactccaccaacgccgac
ggcatcagcgccctgcaccaggcctgcatcgacgagaacctggaggtggtgcgcttcctg
gtggagcagggtgccacggtgaaccaggcagataatgagggctggacacccctgcacgtg
gccgcctcctgtggttacctggacatcgccaggtacctactgagccacggggccaacatc
gccgcggtgaacagtgatggggacctgcccctggacctggccgagtctgacgccatggag
gggctgctgaaggtggagattgcccgccgaggtgtggatgtggaagcagccaaacgggcc
gaggaggagttgctgcttcacgacacaaggtgctggctgaacgggggcgccatgccagag
gcccggcacccccgcacgggggcctctgccctgcacgtggccgctgccaagggctacatc
gaagtgatgaggctgctgcttcaggccggctacgacccggagctgcgggatggggacggc
tggacgcccctgcacgccgcagcccactggggcgtggaggacgcctgccgcctgctggcg
gagcacggcgggggcatggactcgctgacacacgcggggcagcgtccctgtgatctagcg
gatgaggaggtgctgagcctgctggaggagctggcccggaagcaggaggaccttcggaac
caaaaggaagcctcccagagcaggggccaggagccccaggggccctccagcagcaaacac
cgaaggagctctgtatgtcgtctgagcagccgtgagaagatctccctccaggacttgtcc
aaggagcgccggcctggtggggcagggggccccccaatccgggacgaggatgagggagaa
gaaggcccctccgagccaccccctgcagaatccagaacgctcaacggggtctcctccccg
ccaccctccagccccaggagccccatgacccccgacgaggcccccttctccacgcgcttt
ggcctccagaagacggggagctctggggccctaggccctgcggagaggcggggcgccgag
ggtgcctcgggggctgggctgcagcgctccgcctcctcctcgcggctggaagggacctac
actcaggccagggagccccgtcttgccagaattacccccaccccctcccggaaggtgccg
gagtcctctgccccgtctgagatctccaggcctcctcctcccttgggtaactccactcct
gcctccagggttccggagcccgaatccccagtgaagccaaatgtccccgtagcctctgca
gcgcccccagcggactcccgcgaccgccggaggtcctaccagatgcctgtacgggacgag
gagtctgaatctcagcggaaagctcgctctcgcctcatgcgccagtctcggaggtccaca
cagggtgtgactctgacagaccttaaagaagcagagaaggctgcaggaaaggccccagag
ccagagaagtcgtgcctgcaaagcctggacccttcccggcgaccccgagtccccggggtc
gagaactctgatggccctgcccagagagcagaggcgcctgacggccaagggcaaggacca
caggccgccgaggagcaccgcagagtcagcaaggagtggcggggacctgctgagggggag
gaggcggagccggcgcctgcagaccgcagcccaggatccagcactcccgagggcggcccc
tcttcccgcaggcagcgggacctcaacccagaaccagagccagaaccagaagagcctgat
ggaggcttcaggaagctgtatgcagagctgcgcagtgagaacgaacgacttcgcgaggcc
ctgaccgagaccacactgcagctggcgcagctcaaggtggagctggagcgtgccacgcag
aggcaggagcgatttgcagagaggcccgcccttctggagctggagagattcgagcgcagg
gccctggagcggaaggcagcggagctggaggaggagctgaaggccctgtccgacctccgg
gctgacaaccagcgactcaaggatgagaacgcagccctgattcgcgtcatcagcaaactc
tccaagtga

KEGG   Orcinus orca (killer whale): 101279306
Entry
101279306         CDS       T05247                                 

Gene name
PPP1R12A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12A isoform X1
  KO
K06270  protein phosphatase 1 regulatory subunit 12A
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04270  Vascular smooth muscle contraction
oor04510  Focal adhesion
oor04611  Platelet activation
oor04810  Regulation of actin cytoskeleton
oor04921  Oxytocin signaling pathway
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101279306 (PPP1R12A)
   04022 cGMP-PKG signaling pathway
    101279306 (PPP1R12A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101279306 (PPP1R12A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101279306 (PPP1R12A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101279306 (PPP1R12A)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101279306 (PPP1R12A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101279306 (PPP1R12A)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101279306 (PPP1R12A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101279306 (PPP1R12A)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101279306 (PPP1R12A)
SSDB
Motif
Pfam: Ank_4 Ank_2 PRKG1_interact Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 101279306
NCBI-ProteinID: XP_004271631
LinkDB
Position
Unknown
AA seq 1030 aa
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLL
HRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD
IAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD
ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAA
HWGKEEACRILVDSLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKREKKSP
LIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDDEEEGKKDESSCSSEED
EEDDSESEAETDKTKSMASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTSATK
ISPKEEERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDTAGVMRSASSPRLSSSL
DNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKN
SSINEGSAYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGS
SSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTS
EVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTR
EQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTP
SSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGLTKENEREGEKREEEKEGEDKSQPKSI
RERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYEISSTSASDR
YDSLLGRSGSYSYSEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDL
KLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGA
LIRVISKLSK
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgaagatggcggacgcgaagcagaagcggaacgagcagctgaagcgctggatcggctcc
gagacggacctcgagcctcccgtggtgaagcgccagaagaccaaggtgaagttcgatgat
ggcgccgtcttcctggctgcttgctccagcggcgacacggacgaggtcctcaagctgctg
caccgcggcgctgatatcaattacgccaatgtggacggactcactgccctgcaccaggct
tgcattgatgacaatgttgatatggtgaagtttctggtagaaaatggagcaaatattaat
caacctgataatgaaggctggataccactacatgcagctgcttcttgtggatatcttgat
attgcagagtttttgattggtcagggagcacatgtaggagctgtcaacagtgaaggagac
acacctttagatattgctgaggaggaggcaatggaagagctacttcaaaatgaagttaat
cggcaaggggttgatatagaagcagctcgaaaagaagaagaacgaataatgcttagagat
gcaagacaatggctaaatagtggccatataaatgatgtccggcatgcaaaatctggaggt
acagcacttcatgttgcagccgctaaaggctatacagaagttttaaaacttttaatacag
gcgggctatgatgttaatattaaagattatgatggctggacacctcttcatgctgcagct
cattggggtaaagaagaagcatgtcgaattttagtggacagtctgtgtgatatggagatg
gtcaacaaagtgggccagacagcctttgatgtagcagatgaagacattttaggatattta
gaagagttgcaaaagaaacaaaatctgctccatagtgaaaaacgggagaagaagtctcca
ctgattgaatcaacagccaatatggacaataatcaatcacagaaaacctttaaaaacaaa
gagacattgattattgagcctgagaaaaatgcatcccgtattgaatctctggaacaagaa
aaggttgatgatgaagaagaaggaaaaaaagatgaatctagttgctctagtgaagaagat
gaggaagatgactcagaatcagaagctgaaacagataagacaaaatccatggcttctgta
actaatgccaatacttctagtactcaagcagctcctgtagctgttacaacacctactgtg
tcatctggtcaggcaacacctacatcacctattaaaaagtttccaacttcagctacaaaa
atttctcccaaagaagaagagagaaaagatgagtctcctgcatcttggaggttaggactt
agaaagactggtagttatggcgcacttgcagaaatcacagcatctaaagaggctcagaaa
gaaaaagacactgcaggtgttatgcgttcagcttcaagtcccagactttcctcctctttg
gataataaagaaaaggagaaagatagtaaaggaactaggcttgcatatgttgcacctaca
ataccaagacgactagccagtacatctgacattgaagagaaagaaaacagagattcttca
agtttgcgaacaagtagttcatatacaagaagaaaatgggaagatgatctcaaaaagaat
agctcaattaatgaaggatcagcttatcataaaagttgctcctttggtagaagacaagat
gatttgattagttctagtgttccaagcaccacatcaacaccaacagttacctctgcagct
gggcttcagaaaagcctgctttccagcacaagcactactacaaagattacaacgggttct
tcctcagcaggcacacaaagcagtacctcaaatcgtttgtgggctgaggatagtactgaa
aaagaaaaggacagtgttcctacggcagtgaccattcctgttgctccaactgttgtaaat
gctgcagcctctaccacaaccctgactacaactactgctggcactgtctcctccacttca
gaggtcagggagagacgcagatcatacctcactcctgttagagatgaagagtctgaatcc
caaagaaaagcaagatctagacaagcaagacagtctagaagatcaacacagggggtgaca
ttgactgatcttcaggaagctgagaaaacgataggaaggagtcgttctacccgaaccaga
gaacaagaaaatgaagaaaaagaaaaagaagaaaaagaaaaacaggataaagagaagcaa
gaagaaaagaaggagtcagaaacatctagagaagatgaatataaacaaaagtactccaga
acatatgatgagacttatcaacgctacagaccagtatcaacttcaagttcaaccactcca
tcctcttcactttctaccatgagcagttcactctatgcttcaagtcaactaaacaggcca
aatagtcttgtaggtataacttctgcttactccagaggattaacaaaggaaaatgaaaga
gagggagaaaagagagaagaagaaaaagagggagaagataaatcacaacctaaatcaatc
agagaacgacgacgaccaagagagaaaagaagatctacaggagtttcattctggacacaa
gatagtgatgaaaatgaacaagaacaacaatctgatacagaagagggatccaataagaaa
gaaactcagacggattccatttctagatatgaaatcagttctacatcagctagtgatcgg
tatgattccttgctgggtcgctctggatcatacagttactcagaagaaagaaaaccttac
agtagcaggctagaaaaggatgattcaactgactttaaaaagctttatgaacaaattcta
gctgaaaatgaaaagctgaaagcacaactacatgatacaaatatggaactgacagatctt
aaattacaattggaaaaggccacccagagacaagaaagatttgctgataggtcactactg
gaaatggaaaaaagggaacgaagagctctagaaagaagaatatctgaaatggaagaagag
ctcaaaatgttaccagacctaaaagcagacaaccagaggctaaaggatgaaaatggggcc
ttgatcagagttataagcaaactttccaaataa

KEGG   Orcinus orca (killer whale): 101280558
Entry
101280558         CDS       T05247                                 

Gene name
PPP1CB
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-beta catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03015  mRNA surveillance pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04390  Hippo signaling pathway
oor04510  Focal adhesion
oor04611  Platelet activation
oor04720  Long-term potentiation
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04921  Oxytocin signaling pathway
oor04931  Insulin resistance
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05168  Herpes simplex virus 1 infection
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101280558 (PPP1CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101280558 (PPP1CB)
   04024 cAMP signaling pathway
    101280558 (PPP1CB)
   04022 cGMP-PKG signaling pathway
    101280558 (PPP1CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101280558 (PPP1CB)
   04218 Cellular senescence
    101280558 (PPP1CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101280558 (PPP1CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101280558 (PPP1CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101280558 (PPP1CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101280558 (PPP1CB)
   04921 Oxytocin signaling pathway
    101280558 (PPP1CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101280558 (PPP1CB)
   04270 Vascular smooth muscle contraction
    101280558 (PPP1CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    101280558 (PPP1CB)
   04720 Long-term potentiation
    101280558 (PPP1CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101280558 (PPP1CB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101280558 (PPP1CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101280558 (PPP1CB)
   05034 Alcoholism
    101280558 (PPP1CB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101280558 (PPP1CB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101280558 (PPP1CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101280558 (PPP1CB)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oor03021]
    101280558 (PPP1CB)
   03019 Messenger RNA biogenesis [BR:oor03019]
    101280558 (PPP1CB)
   03041 Spliceosome [BR:oor03041]
    101280558 (PPP1CB)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101280558 (PPP1CB)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     101280558 (PPP1CB)
Transcription machinery [BR:oor03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     101280558 (PPP1CB)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101280558 (PPP1CB)
Spliceosome [BR:oor03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101280558 (PPP1CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 101280558
NCBI-ProteinID: XP_004268218
LinkDB
Position
Unknown
AA seq 327 aa
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggatagtctcatcacccgactgctggaggtacgagga
tgtcgtccaggaaagattgtgcagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttctcagccagcctattcttttggaattggaagcgccactgaaaatt
tgtggagatattcatggacagtatacagatttactgcgattatttgaatatggaggtttc
cccccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctgttggcctataaaatcaaatatcccgagaacttctttctctta
agaggaaaccatgagtgtgctagcatcaatcgcatttatggattctatgatgaatgcaaa
cgaaggtttaatattaaattgtggaagaccttcactgattgtttcaactgtctgcctata
gctgccattgtggatgagaagatcttctgttgtcatggaggactgtcaccagacttgcaa
tccatggagcagattcggagaattatgagacccactgatgtccctgatacagggttgctc
tgtgatttgctgtggtctgacccagataaggatgtgcaaggttggggagaaaatgatcgt
ggtgtttccttcacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gacttgatttgtcgagctcatcaggtggtggaagatggatatgaattctttgctaagcga
caattggtaaccctattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccaatatggtggactgaattcaggacgtcccgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

KEGG   Orcinus orca (killer whale): 101285623
Entry
101285623         CDS       T05247                                 

Gene name
PPP1CA
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03015  mRNA surveillance pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04390  Hippo signaling pathway
oor04510  Focal adhesion
oor04611  Platelet activation
oor04720  Long-term potentiation
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04921  Oxytocin signaling pathway
oor04931  Insulin resistance
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05168  Herpes simplex virus 1 infection
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101285623 (PPP1CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101285623 (PPP1CA)
   04024 cAMP signaling pathway
    101285623 (PPP1CA)
   04022 cGMP-PKG signaling pathway
    101285623 (PPP1CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101285623 (PPP1CA)
   04218 Cellular senescence
    101285623 (PPP1CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101285623 (PPP1CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101285623 (PPP1CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101285623 (PPP1CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101285623 (PPP1CA)
   04921 Oxytocin signaling pathway
    101285623 (PPP1CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101285623 (PPP1CA)
   04270 Vascular smooth muscle contraction
    101285623 (PPP1CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    101285623 (PPP1CA)
   04720 Long-term potentiation
    101285623 (PPP1CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101285623 (PPP1CA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101285623 (PPP1CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101285623 (PPP1CA)
   05034 Alcoholism
    101285623 (PPP1CA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101285623 (PPP1CA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101285623 (PPP1CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101285623 (PPP1CA)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oor03021]
    101285623 (PPP1CA)
   03019 Messenger RNA biogenesis [BR:oor03019]
    101285623 (PPP1CA)
   03041 Spliceosome [BR:oor03041]
    101285623 (PPP1CA)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101285623 (PPP1CA)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     101285623 (PPP1CA)
Transcription machinery [BR:oor03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     101285623 (PPP1CA)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101285623 (PPP1CA)
Spliceosome [BR:oor03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101285623 (PPP1CA)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 101285623
NCBI-ProteinID: XP_004278055
LinkDB
Position
Unknown
AA seq 330 aa
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggactctatcatcgggcgcctgctggaagtgcag
ggctcgcggcctggaaagaatgtacagctgacagagaacgagatccgtggtctgtgcctc
aaatcccgggagattttcctgagccagcccattcttctggagctggaggcacccctcaag
atctgtggcgacattcatggccagtactacgaccttctgcggctgttcgagtatggcggc
ttccctccagagagcaactacctgtttctgggggactatgtggacaggggcaagcagtct
ttggagaccatctgcttgctgctggcctataagatcaagtaccccgagaacttcttcctg
ctccgtgggaaccacgagtgcgccagcatcaaccgcatctacggcttctacgatgagtgc
aagagacgctacaacatcaaactatggaaaaccttcaccgattgcttcaactgcctgcct
attgctgccattgtggatgaaaagatcttctgctgtcacgggggcctgtccccggaccta
cagtccatggagcagatccggcgtatcatgcggcctacagacgtgccagaccagggcctg
ctgtgtgacctgctgtggtctgaccctgacaaggacgtgcagggctggggcgagaatgac
cgtggcgtctcctttacctttggagctgaggtcgtggccaagttcctgcacaagcacgac
ctggatctcatctgccgggcacaccaggtggtagaagatggctatgagttctttgccaag
cggcagctggtgacactcttctcagctcctaactactgtggcgagtttgacaacgcaggc
gccatgatgagcgtggacgagacgctcatgtgctccttccagatcctcaagcccgccgac
aagaacaaggggaaatatgggcagttcagcggcctgaaccctggaggccggcccatcacc
ccgccccgcaactccgccaaagccaagaaatag

KEGG   Orcinus orca (killer whale): 101286983
Entry
101286983         CDS       T05247                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03015  mRNA surveillance pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04114  Oocyte meiosis
oor04218  Cellular senescence
oor04261  Adrenergic signaling in cardiomyocytes
oor04270  Vascular smooth muscle contraction
oor04390  Hippo signaling pathway
oor04510  Focal adhesion
oor04611  Platelet activation
oor04720  Long-term potentiation
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04921  Oxytocin signaling pathway
oor04931  Insulin resistance
oor05031  Amphetamine addiction
oor05034  Alcoholism
oor05168  Herpes simplex virus 1 infection
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    101286983 (PPP1CC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101286983 (PPP1CC)
   04024 cAMP signaling pathway
    101286983 (PPP1CC)
   04022 cGMP-PKG signaling pathway
    101286983 (PPP1CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101286983 (PPP1CC)
   04218 Cellular senescence
    101286983 (PPP1CC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101286983 (PPP1CC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101286983 (PPP1CC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101286983 (PPP1CC)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101286983 (PPP1CC)
   04921 Oxytocin signaling pathway
    101286983 (PPP1CC)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101286983 (PPP1CC)
   04270 Vascular smooth muscle contraction
    101286983 (PPP1CC)
  09156 Nervous system
   04728 Dopaminergic synapse
    101286983 (PPP1CC)
   04720 Long-term potentiation
    101286983 (PPP1CC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101286983 (PPP1CC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101286983 (PPP1CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    101286983 (PPP1CC)
   05034 Alcoholism
    101286983 (PPP1CC)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101286983 (PPP1CC)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101286983 (PPP1CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101286983 (PPP1CC)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:oor03021]
    101286983 (PPP1CC)
   03019 Messenger RNA biogenesis [BR:oor03019]
    101286983 (PPP1CC)
   03041 Spliceosome [BR:oor03041]
    101286983 (PPP1CC)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101286983 (PPP1CC)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     101286983 (PPP1CC)
Transcription machinery [BR:oor03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     101286983 (PPP1CC)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     101286983 (PPP1CC)
Spliceosome [BR:oor03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    101286983 (PPP1CC)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 101286983
NCBI-ProteinID: XP_012390979
LinkDB
Position
Unknown
AA seq 323 aa
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggatatagataagctcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagctacaggagaatgaaatcagaggattgtgctta
aagtccagagagatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgatatccatggacaatactatgatttgcttcgactttttgagtacggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagactatttgcctcttattggcttacaaaatcaaatatcccgagaatttttttctt
ctcagaggaaaccacgaatgtgccagcatcaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaaactatggaaaactttcacagactgctttaactgtttaccg
atagcagccatcgtggatgagaaaatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcacccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggacgaaacactaatgtgttcttttcagattttaaaacctgcagaa
aaaaagaagccgaatgccacgaggcccgtaacacctccaaggggtatgatcacaaagcaa
gcaaagaaatag

KEGG   Orcinus orca (killer whale): 101289221
Entry
101289221         CDS       T05247                                 

Gene name
PPP1R12B
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 12B
  KO
K12329  protein phosphatase 1 regulatory subunit 12B
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04270  Vascular smooth muscle contraction
oor04510  Focal adhesion
oor04810  Regulation of actin cytoskeleton
oor04921  Oxytocin signaling pathway
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101289221 (PPP1R12B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101289221 (PPP1R12B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101289221 (PPP1R12B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101289221 (PPP1R12B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101289221 (PPP1R12B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101289221 (PPP1R12B)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101289221 (PPP1R12B)
SSDB
Motif
Pfam: Ank_2 Ank_4 PRKG1_interact Ank_5 Ank_3 Ank MEDS
Other DBs
NCBI-GeneID: 101289221
NCBI-ProteinID: XP_004285435
LinkDB
Position
Unknown
AA seq 976 aa
MAEMEHLGGKRAESARARRAEQLRRWRGSLTEQEPADRPGAELPPQAQRGGPRVRFEDGA
VFLAACSSGDTDEVRRLLARGADVDTANVDGLTALHQACIDENVDMVKFLVENGASVNQQ
DSEGWTPLHAAASCGHLNIAEYFINHGASVGVVNSEGEVPSDLAEEPAMKDLLLQQVKKQ
GVDLEQSRKAEEQQMLQDARQWLNSGKIQDVRQARSGATALHVAAAKGYYEVLRLLTQAG
YELNVQDRDGWTPLHAAAHWGVKEACSILAEALCDMDVRSKLGQTPFDVADEGLVEHLEM
LQKKQSVLRSEKETRNKLIESDLNSKLHGRLFKNKEKMLYEEETPKPQEMEDENKESSSS
SSDEDEGEDEASESETEKEADKKPGAIVNRSNSESKSSAAEQTPAPAQIISSTSSARRFS
GLFNKPEEPRDESPSSWRLGLRKTGSQNVLGEAARSREALRDRGASIHRSASSPRISTVL
DTREKERESRSSFSALGPRRLSAASDLEEKENRESAAHLVRSGPPARQLRRDGAEGSESL
QTAAPSTYVTTYLKRPPYKSQADSAAERTVDGVSCGTPLCVITNRPPPSTANGVTAAALL
STPGTDSSVEARERRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERTF
SRSRAERQAQEQPSPKPVGPRGLDGSAQKHEPLAAPAEEAGESRQPWDRSLEDQPVYRRL
RIPAQPDKPMTPVSPPAPRPSLYTSSYLLRTGRSSAPDSESSEPPASPAGAKEMDKNEGE
EADLGDQSSNRLSIRERRRPKERRRGTGINFWTKDEDETDVSEEVKAAWHERLSRLELGG
SDASSERASARARREAREARLATLSSRAGEDSSRDYRKLYESALTENQKLKTKLQEAQLE
LADVKSKLEKMAQQKQDKTADRSSVLEMEKRERRALERKMSEMEEEMKVLTELKSDNQRL
KDENGALIRVISKLSK
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggcggagatggagcacctgggcgggaagcgggccgagtcggcgcgggcacggcgggcc
gagcagctgcggcgctggcggggctcgctgacggagcaagagcccgccgaccggccgggc
gcggagctgccgccgcaggctcagcgcgggggcccgcgggtccgcttcgaggacggcgct
gtgttcctggccgcctgctctagcggggacaccgacgaggtgaggcggctcctggcccgg
ggcgccgacgtggacacggccaacgtggacggcctgaccgccctgcaccaggcttgtatt
gatgaaaatgtggacatggtgaagttcctggtggagaacggagccagtgtgaaccagcag
gacagcgagggctggacgcccctccacgcagcagcgtcctgtggccacctcaacatcgcg
gagtatttcattaaccatggagctagcgtgggtgttgtgaacagtgaaggggaagtcccc
tcggacctcgcagaagagcctgccatgaaggatcttcttctgcagcaagtgaagaagcaa
ggggtcgatctcgagcagtcgaggaaggcagaggaacagcagatgctgcaggacgcccgc
cagtggctcaacagcgggaaaatacaggatgtgaggcaggcgcgctcaggggccactgcc
ctccacgtggctgccgccaagggctactatgaggtcctcagacttttgactcaggctggc
tatgagctcaatgtccaggaccgcgacggctggaccccgctccatgccgccgcacactgg
ggggtgaaggaggcgtgctccatcctggcagaagccctctgtgacatggacgtcaggagc
aaactgggccagacaccgtttgatgtggctgacgagggcctcgtggagcacctggagatg
ctgcagaagaagcagagcgtgcttcgaagtgaaaaagagacacggaataagctcattgag
tcggacctgaacagcaagttgcacggtagactctttaagaacaaagagaagatgctctat
gaggaggagacaccaaagccccaagaaatggaggatgaaaacaaagaatccagcagctcc
agctcagacgaggacgaaggtgaagatgaggcttctgagtcagaaactgagaaggaggcg
gataaaaagccgggagccatcgtcaaccgttccaactccgaaagcaagagtagtgccgcc
gagcagacaccagcaccagcgcagatcatctcctccacctcttcagccaggagattctcc
ggccttttcaacaagccggaagagcccagagatgagtctccgtcttcgtggaggctgggc
ctcaggaagaccggcagccagaacgtgctgggcgaggcggccaggtccagggaggccctg
cgggaccggggcgcgtccatccaccgctcggcctccagcccccgcatctccactgtgctg
gacaccagagaaaaggagcgagaaagcagaagctctttcagcgcactggggccgcggagg
ctgagcgccgccagcgacctggaggagaaggagaacagagagtcggctgctcacctggtg
cggagtggcccccccgcccgccagctgcggagggacggagcggaggggagtgaatctctg
cagacagccgccccttccacctacgtgacaacctacctgaaaaggcctccttacaaatcc
caggctgactccgcagcggagagaacagtagacggtgtctcttgcggcaccccgctctgt
gtgatcacgaatcgccccccacctagcactgccaatggggttacagctgccgctctgctc
tccactcctggaacggactcctctgtggaagccagggagaggaggaggtcgtatctgact
cctgtacgggacgaggaagcagagtcgttacggaaagcgcgctccagacaggctcggcag
actcgcaggtctacccaaggtgtaaccctgacggatctccaggaagcagaaaggacgttc
agccggtcgagggcagagcgtcaggctcaggaacagcccagcccgaagcccgtgggcccc
agagggctcgacggcagcgcccagaagcatgagcccctggcagcccctgcagaggaagct
ggggagagccgccagccctgggaccggagtctggaggatcagcctgtgtatcgtcgcctg
aggattccggctcagccagacaaacccatgacaccagtgtcacctcctgccccgagaccc
tccctctacaccagttcctacctgctccggacgggtaggtcttcagcccctgattcagag
agttcagagccccccgccagccctgcaggggcaaaggaaatggacaaaaacgagggcgaa
gaagcagatttgggtgatcagtcgtctaacaggctgtccattcgtgagaggaggcggccc
aaggagcgacgaagaggcacaggcatcaacttctggacgaaggatgaagatgaaactgat
gtctcggaagaggtgaaagcagcatggcatgaacgactttctaggttggaattgggaggc
agtgacgccagcagcgagcgggcctcggccagagcccgccgggaggcccgcgaggcccgc
ctggccaccctgagcagccgcgcgggggaagacagcagcagggactacagaaagctctac
gagagcgccctgaccgaaaaccagaaactgaagacaaaacttcaggaggcccagctcgag
ctggcagacgtgaaatccaagcttgagaagatggcccagcagaaacaagacaagaccgcc
gaccggtcgtcggtgctggagatggagaagcgggagaggcgagccttggagcggaagatg
tcggagatggaggaggagatgaaggtcctgacagaactgaaatccgacaaccagaggctg
aaggacgagaacggcgccctcatcagggtcatcagcaagctgtccaagtag

DBGET integrated database retrieval system