KEGG   Orcinus orca (killer whale): 101277568
Entry
101277568         CDS       T05247                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05020  Prion disease
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05142  Chagas disease
oor05146  Amoebiasis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101277568 (PIK3R3)
   04014 Ras signaling pathway
    101277568 (PIK3R3)
   04015 Rap1 signaling pathway
    101277568 (PIK3R3)
   04370 VEGF signaling pathway
    101277568 (PIK3R3)
   04630 JAK-STAT signaling pathway
    101277568 (PIK3R3)
   04668 TNF signaling pathway
    101277568 (PIK3R3)
   04066 HIF-1 signaling pathway
    101277568 (PIK3R3)
   04068 FoxO signaling pathway
    101277568 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    101277568 (PIK3R3)
   04072 Phospholipase D signaling pathway
    101277568 (PIK3R3)
   04071 Sphingolipid signaling pathway
    101277568 (PIK3R3)
   04024 cAMP signaling pathway
    101277568 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    101277568 (PIK3R3)
   04152 AMPK signaling pathway
    101277568 (PIK3R3)
   04150 mTOR signaling pathway
    101277568 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101277568 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    101277568 (PIK3R3)
   04218 Cellular senescence
    101277568 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101277568 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101277568 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101277568 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101277568 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    101277568 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    101277568 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    101277568 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    101277568 (PIK3R3)
   04660 T cell receptor signaling pathway
    101277568 (PIK3R3)
   04662 B cell receptor signaling pathway
    101277568 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    101277568 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    101277568 (PIK3R3)
   04670 Leukocyte transendothelial migration
    101277568 (PIK3R3)
   04062 Chemokine signaling pathway
    101277568 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101277568 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    101277568 (PIK3R3)
   04929 GnRH secretion
    101277568 (PIK3R3)
   04915 Estrogen signaling pathway
    101277568 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    101277568 (PIK3R3)
   04917 Prolactin signaling pathway
    101277568 (PIK3R3)
   04926 Relaxin signaling pathway
    101277568 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    101277568 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    101277568 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101277568 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101277568 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    101277568 (PIK3R3)
   04722 Neurotrophin signaling pathway
    101277568 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101277568 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    101277568 (PIK3R3)
   04380 Osteoclast differentiation
    101277568 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    101277568 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    101277568 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101277568 (PIK3R3)
   05206 MicroRNAs in cancer
    101277568 (PIK3R3)
   05205 Proteoglycans in cancer
    101277568 (PIK3R3)
   05203 Viral carcinogenesis
    101277568 (PIK3R3)
   05230 Central carbon metabolism in cancer
    101277568 (PIK3R3)
   05231 Choline metabolism in cancer
    101277568 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101277568 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101277568 (PIK3R3)
   05212 Pancreatic cancer
    101277568 (PIK3R3)
   05225 Hepatocellular carcinoma
    101277568 (PIK3R3)
   05226 Gastric cancer
    101277568 (PIK3R3)
   05214 Glioma
    101277568 (PIK3R3)
   05221 Acute myeloid leukemia
    101277568 (PIK3R3)
   05220 Chronic myeloid leukemia
    101277568 (PIK3R3)
   05218 Melanoma
    101277568 (PIK3R3)
   05211 Renal cell carcinoma
    101277568 (PIK3R3)
   05215 Prostate cancer
    101277568 (PIK3R3)
   05213 Endometrial cancer
    101277568 (PIK3R3)
   05224 Breast cancer
    101277568 (PIK3R3)
   05222 Small cell lung cancer
    101277568 (PIK3R3)
   05223 Non-small cell lung cancer
    101277568 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101277568 (PIK3R3)
   05017 Spinocerebellar ataxia
    101277568 (PIK3R3)
   05020 Prion disease
    101277568 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101277568 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101277568 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    101277568 (PIK3R3)
   04931 Insulin resistance
    101277568 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101277568 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101277568 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    101277568 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101277568 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    101277568 (PIK3R3)
   05161 Hepatitis B
    101277568 (PIK3R3)
   05160 Hepatitis C
    101277568 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    101277568 (PIK3R3)
   05164 Influenza A
    101277568 (PIK3R3)
   05162 Measles
    101277568 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    101277568 (PIK3R3)
   05163 Human cytomegalovirus infection
    101277568 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101277568 (PIK3R3)
   05169 Epstein-Barr virus infection
    101277568 (PIK3R3)
   05165 Human papillomavirus infection
    101277568 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101277568 (PIK3R3)
   05142 Chagas disease
    101277568 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101277568 (PIK3R3)
   01524 Platinum drug resistance
    101277568 (PIK3R3)
   01522 Endocrine resistance
    101277568 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101277568 (PIK3R3)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101277568 (PIK3R3)
SSDB
Motif
Pfam: SH2 PI3K_P85_iSH2 Mod_r Laminin_I Transcrip_act Bap31_Bap29_C Tropomyosin_1 TMPIT Exonuc_VII_L
Other DBs
NCBI-GeneID: 101277568
NCBI-ProteinID: XP_004285803
LinkDB
Position
Unknown
AA seq 402 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGMKDGSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERWLNHKGVRQKRLNAWLGIKNEDAAETYFINEEDENLPHYDEKTWF
VEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPY
NLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccattacaaatggaatgaaggacggttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gacatgccagacggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattac
actttgactctgcggaagggaggcaataataagctaataaagatctatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattagccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaaa
ctgcaagagtatcactctcagtatcaggaaaagagtaaagagtatgacaggctatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcatacacaagaacaacatagcaaagaatat
attgagcgatttcggaaagaggggaatgaaaaggaaattgaacggtggctcaatcacaaa
ggagtaagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgctgag
acctattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggttt
gttgaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgca
ttcttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgctgatggg
gaagtgaagcactgcgtgatctacagcactgctcggggctatggctttgcagagccctac
aacctgtacagctcactgaaggagctggtgctccactaccagcagacatccctcgtccag
cacaatgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcgctc
tgcagataa

KEGG   Orcinus orca (killer whale): 101278075
Entry
101278075         CDS       T05247                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00562  Inositol phosphate metabolism
oor01100  Metabolic pathways
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05020  Prion disease
oor05100  Bacterial invasion of epithelial cells
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05146  Amoebiasis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101278075 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101278075 (PIK3CA)
   04014 Ras signaling pathway
    101278075 (PIK3CA)
   04015 Rap1 signaling pathway
    101278075 (PIK3CA)
   04370 VEGF signaling pathway
    101278075 (PIK3CA)
   04630 JAK-STAT signaling pathway
    101278075 (PIK3CA)
   04668 TNF signaling pathway
    101278075 (PIK3CA)
   04066 HIF-1 signaling pathway
    101278075 (PIK3CA)
   04068 FoxO signaling pathway
    101278075 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    101278075 (PIK3CA)
   04072 Phospholipase D signaling pathway
    101278075 (PIK3CA)
   04071 Sphingolipid signaling pathway
    101278075 (PIK3CA)
   04024 cAMP signaling pathway
    101278075 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    101278075 (PIK3CA)
   04152 AMPK signaling pathway
    101278075 (PIK3CA)
   04150 mTOR signaling pathway
    101278075 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101278075 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    101278075 (PIK3CA)
   04218 Cellular senescence
    101278075 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101278075 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    101278075 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101278075 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101278075 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    101278075 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    101278075 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    101278075 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    101278075 (PIK3CA)
   04660 T cell receptor signaling pathway
    101278075 (PIK3CA)
   04662 B cell receptor signaling pathway
    101278075 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    101278075 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    101278075 (PIK3CA)
   04670 Leukocyte transendothelial migration
    101278075 (PIK3CA)
   04062 Chemokine signaling pathway
    101278075 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101278075 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    101278075 (PIK3CA)
   04929 GnRH secretion
    101278075 (PIK3CA)
   04915 Estrogen signaling pathway
    101278075 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    101278075 (PIK3CA)
   04917 Prolactin signaling pathway
    101278075 (PIK3CA)
   04926 Relaxin signaling pathway
    101278075 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    101278075 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    101278075 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101278075 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101278075 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    101278075 (PIK3CA)
   04722 Neurotrophin signaling pathway
    101278075 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101278075 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    101278075 (PIK3CA)
   04380 Osteoclast differentiation
    101278075 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    101278075 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    101278075 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101278075 (PIK3CA)
   05206 MicroRNAs in cancer
    101278075 (PIK3CA)
   05205 Proteoglycans in cancer
    101278075 (PIK3CA)
   05203 Viral carcinogenesis
    101278075 (PIK3CA)
   05230 Central carbon metabolism in cancer
    101278075 (PIK3CA)
   05231 Choline metabolism in cancer
    101278075 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101278075 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101278075 (PIK3CA)
   05212 Pancreatic cancer
    101278075 (PIK3CA)
   05225 Hepatocellular carcinoma
    101278075 (PIK3CA)
   05226 Gastric cancer
    101278075 (PIK3CA)
   05214 Glioma
    101278075 (PIK3CA)
   05221 Acute myeloid leukemia
    101278075 (PIK3CA)
   05220 Chronic myeloid leukemia
    101278075 (PIK3CA)
   05218 Melanoma
    101278075 (PIK3CA)
   05211 Renal cell carcinoma
    101278075 (PIK3CA)
   05215 Prostate cancer
    101278075 (PIK3CA)
   05213 Endometrial cancer
    101278075 (PIK3CA)
   05224 Breast cancer
    101278075 (PIK3CA)
   05222 Small cell lung cancer
    101278075 (PIK3CA)
   05223 Non-small cell lung cancer
    101278075 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101278075 (PIK3CA)
   05017 Spinocerebellar ataxia
    101278075 (PIK3CA)
   05020 Prion disease
    101278075 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101278075 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101278075 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    101278075 (PIK3CA)
   04931 Insulin resistance
    101278075 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101278075 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101278075 (PIK3CA)
   05135 Yersinia infection
    101278075 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    101278075 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101278075 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    101278075 (PIK3CA)
   05161 Hepatitis B
    101278075 (PIK3CA)
   05160 Hepatitis C
    101278075 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    101278075 (PIK3CA)
   05164 Influenza A
    101278075 (PIK3CA)
   05162 Measles
    101278075 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    101278075 (PIK3CA)
   05163 Human cytomegalovirus infection
    101278075 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101278075 (PIK3CA)
   05169 Epstein-Barr virus infection
    101278075 (PIK3CA)
   05165 Human papillomavirus infection
    101278075 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101278075 (PIK3CA)
   05142 Chagas disease
    101278075 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101278075 (PIK3CA)
   01524 Platinum drug resistance
    101278075 (PIK3CA)
   01522 Endocrine resistance
    101278075 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101278075 (PIK3CA)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101278075 (PIK3CA)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101278075 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 101278075
NCBI-ProteinID: XP_004270569
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcgagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatctcaattcaccgcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgacgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcacttaggataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttctatttgttctgttaaaggccgaaagggtgctaaagaggaacattgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaggattttctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcgatgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctacttgtgaggtttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatttgaag
cacctgaataggcaggttgaggctatggaaaagctcattaacttaactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaaatttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctgtcgcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcagattattcgcattatg
gaaaatatatggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtcc
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgtaaaggaggcctgaaaggtgccctgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccatcgatctatttacacgttca
tgtgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacagtcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaggaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Orcinus orca (killer whale): 101278974
Entry
101278974         CDS       T05247                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X2
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00562  Inositol phosphate metabolism
oor01100  Metabolic pathways
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05020  Prion disease
oor05100  Bacterial invasion of epithelial cells
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05146  Amoebiasis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101278974 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101278974 (PIK3CD)
   04014 Ras signaling pathway
    101278974 (PIK3CD)
   04015 Rap1 signaling pathway
    101278974 (PIK3CD)
   04370 VEGF signaling pathway
    101278974 (PIK3CD)
   04630 JAK-STAT signaling pathway
    101278974 (PIK3CD)
   04668 TNF signaling pathway
    101278974 (PIK3CD)
   04066 HIF-1 signaling pathway
    101278974 (PIK3CD)
   04068 FoxO signaling pathway
    101278974 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101278974 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101278974 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101278974 (PIK3CD)
   04024 cAMP signaling pathway
    101278974 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101278974 (PIK3CD)
   04152 AMPK signaling pathway
    101278974 (PIK3CD)
   04150 mTOR signaling pathway
    101278974 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101278974 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    101278974 (PIK3CD)
   04218 Cellular senescence
    101278974 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101278974 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101278974 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101278974 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101278974 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    101278974 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101278974 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101278974 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101278974 (PIK3CD)
   04660 T cell receptor signaling pathway
    101278974 (PIK3CD)
   04662 B cell receptor signaling pathway
    101278974 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101278974 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101278974 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101278974 (PIK3CD)
   04062 Chemokine signaling pathway
    101278974 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101278974 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    101278974 (PIK3CD)
   04929 GnRH secretion
    101278974 (PIK3CD)
   04915 Estrogen signaling pathway
    101278974 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101278974 (PIK3CD)
   04917 Prolactin signaling pathway
    101278974 (PIK3CD)
   04926 Relaxin signaling pathway
    101278974 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    101278974 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101278974 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101278974 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101278974 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    101278974 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101278974 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101278974 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    101278974 (PIK3CD)
   04380 Osteoclast differentiation
    101278974 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    101278974 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101278974 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101278974 (PIK3CD)
   05206 MicroRNAs in cancer
    101278974 (PIK3CD)
   05205 Proteoglycans in cancer
    101278974 (PIK3CD)
   05203 Viral carcinogenesis
    101278974 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101278974 (PIK3CD)
   05231 Choline metabolism in cancer
    101278974 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101278974 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101278974 (PIK3CD)
   05212 Pancreatic cancer
    101278974 (PIK3CD)
   05225 Hepatocellular carcinoma
    101278974 (PIK3CD)
   05226 Gastric cancer
    101278974 (PIK3CD)
   05214 Glioma
    101278974 (PIK3CD)
   05221 Acute myeloid leukemia
    101278974 (PIK3CD)
   05220 Chronic myeloid leukemia
    101278974 (PIK3CD)
   05218 Melanoma
    101278974 (PIK3CD)
   05211 Renal cell carcinoma
    101278974 (PIK3CD)
   05215 Prostate cancer
    101278974 (PIK3CD)
   05213 Endometrial cancer
    101278974 (PIK3CD)
   05224 Breast cancer
    101278974 (PIK3CD)
   05222 Small cell lung cancer
    101278974 (PIK3CD)
   05223 Non-small cell lung cancer
    101278974 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101278974 (PIK3CD)
   05017 Spinocerebellar ataxia
    101278974 (PIK3CD)
   05020 Prion disease
    101278974 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101278974 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101278974 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    101278974 (PIK3CD)
   04931 Insulin resistance
    101278974 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101278974 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101278974 (PIK3CD)
   05135 Yersinia infection
    101278974 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    101278974 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101278974 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    101278974 (PIK3CD)
   05161 Hepatitis B
    101278974 (PIK3CD)
   05160 Hepatitis C
    101278974 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    101278974 (PIK3CD)
   05164 Influenza A
    101278974 (PIK3CD)
   05162 Measles
    101278974 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    101278974 (PIK3CD)
   05163 Human cytomegalovirus infection
    101278974 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101278974 (PIK3CD)
   05169 Epstein-Barr virus infection
    101278974 (PIK3CD)
   05165 Human papillomavirus infection
    101278974 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101278974 (PIK3CD)
   05142 Chagas disease
    101278974 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101278974 (PIK3CD)
   01524 Platinum drug resistance
    101278974 (PIK3CD)
   01522 Endocrine resistance
    101278974 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101278974 (PIK3CD)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101278974 (PIK3CD)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101278974 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 101278974
NCBI-ProteinID: XP_004272415
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRAKMRQFCEEVAAHRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSHPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPLKKPASVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKNQLKTGERCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAP
HPVYYPALDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVLYSNEEAGSDGTVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDHTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagagcgtg
gctgttgatttcttgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccgctgttccac
atgctcagtgaccccgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcggctgtgcgacatccagcccttcctgcccgtcctgcgc
ctggtggcccgcgagggtgaccgggtgaagaagctcatcaactcgcagatcagcttgctc
atcggcaaaggcctccacgagtttgactccttgcaagacccggaggtgaatgacttccga
gccaagatgcgccagttctgcgaggaggtggccgcgcaccggcagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcggcgcggagctgggggccg
ggcaccctgcgcgtccccaaccgggccctgctcgtcaacgtcaagttcgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggatgtgcccctggcactgatggcctgcgcg
ctccggaagaaggccacggtgttccggcagccgctggtagagcagcccgaggactacaca
ctgcaggtgaacgggaagcacgagtacctgtacggcagccaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgaccatggtgcactcctct
tccatcctcgccatgcgggatgagcagagcaaccccgccccccaagtccaaaagccacgc
gccaaaccgccccccattcctctgaagaagcccgcctcggtgtccctgtggtccctggaa
cagcctttctgcatcgagctgatccagggcagcaaagtgaatgccgatgagcggatgaag
ctggtggtgcaggccggcctcttccacggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcagagcctgtgtggaagcagcggctggagttcgacatcaac
atctgtgacctaccgcgcatggcccgcctctgctttgcgctctacgccgtgatcgagaag
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgattacaagaaccagctcaagaccggcgagcgctgcctctac
atgtggccctccgtcccagacgagaaaggggagctactgaacccctgtgggaccgtgcgg
agtaaccccaacactgagagcgcagccgccctggtcatctttctccctgaggtggccccc
caccctgtatactaccctgccctggacaagatcctagagctggggcggcatggggagcac
gggcgcttcacggaggaggagcagctgcagctgcgggagatcctggagcgccgggggtcc
ggggagctatacgagcacgagaaggacctggtgtggaagatgcggcacgagatccaggag
cacttccccgaggcgctggcccggttgctgctggtcaccaagtggaacaagcacgaggac
gtggcccagatgctctacctgctgtgctcctggcccgagctgcccgtcctgagcgccctg
gagctgctggacttcagcttccctgaccgccacgtgggctcctttgccatcaagtccctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaagatcggccacttcctcttctggcacctgcgctccgagatgcacgtgccctcggtg
gccctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccatcacatgaag
gtcctgatgaagcagggggaggcgctgagcaagctgaaagccctgaacgacgtcgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccgctcgaccccagcaccctg
ctggccgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
gtcctgtacagcaatgaggaggcgggcagcgatggcaccgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctgatggacgttctg
tggaagcaggagggcttggacctgaggatgaccccttacggctgcctctccaccggggac
cacacaggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctgaac
aagagcaacatggcggccacggctgccttcaacaaggatgctctgctcaactggctcaag
tccaagaaccctggggaggccctggatcgagccattgaggagttcaccctctcctgcgct
ggctactgtgtggccacatacgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgggagaacgggcagctgttccacattgatttcggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccgttcatcctcacctatgactttgtgcac
gtgatccagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggctgctctttctccacctctttgccctc
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggat
tctctggcattggggaagacggaggaggaggctctaaagcacttccgggtgaagtttaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaatag

KEGG   Orcinus orca (killer whale): 101281352
Entry
101281352         CDS       T05247                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05020  Prion disease
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05142  Chagas disease
oor05146  Amoebiasis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101281352 (PIK3R2)
   04014 Ras signaling pathway
    101281352 (PIK3R2)
   04015 Rap1 signaling pathway
    101281352 (PIK3R2)
   04370 VEGF signaling pathway
    101281352 (PIK3R2)
   04630 JAK-STAT signaling pathway
    101281352 (PIK3R2)
   04668 TNF signaling pathway
    101281352 (PIK3R2)
   04066 HIF-1 signaling pathway
    101281352 (PIK3R2)
   04068 FoxO signaling pathway
    101281352 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    101281352 (PIK3R2)
   04072 Phospholipase D signaling pathway
    101281352 (PIK3R2)
   04071 Sphingolipid signaling pathway
    101281352 (PIK3R2)
   04024 cAMP signaling pathway
    101281352 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    101281352 (PIK3R2)
   04152 AMPK signaling pathway
    101281352 (PIK3R2)
   04150 mTOR signaling pathway
    101281352 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101281352 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    101281352 (PIK3R2)
   04218 Cellular senescence
    101281352 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101281352 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101281352 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101281352 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101281352 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    101281352 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    101281352 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    101281352 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    101281352 (PIK3R2)
   04660 T cell receptor signaling pathway
    101281352 (PIK3R2)
   04662 B cell receptor signaling pathway
    101281352 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    101281352 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    101281352 (PIK3R2)
   04670 Leukocyte transendothelial migration
    101281352 (PIK3R2)
   04062 Chemokine signaling pathway
    101281352 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101281352 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    101281352 (PIK3R2)
   04929 GnRH secretion
    101281352 (PIK3R2)
   04915 Estrogen signaling pathway
    101281352 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    101281352 (PIK3R2)
   04917 Prolactin signaling pathway
    101281352 (PIK3R2)
   04926 Relaxin signaling pathway
    101281352 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    101281352 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    101281352 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101281352 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101281352 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    101281352 (PIK3R2)
   04722 Neurotrophin signaling pathway
    101281352 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101281352 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    101281352 (PIK3R2)
   04380 Osteoclast differentiation
    101281352 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    101281352 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    101281352 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101281352 (PIK3R2)
   05206 MicroRNAs in cancer
    101281352 (PIK3R2)
   05205 Proteoglycans in cancer
    101281352 (PIK3R2)
   05203 Viral carcinogenesis
    101281352 (PIK3R2)
   05230 Central carbon metabolism in cancer
    101281352 (PIK3R2)
   05231 Choline metabolism in cancer
    101281352 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101281352 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101281352 (PIK3R2)
   05212 Pancreatic cancer
    101281352 (PIK3R2)
   05225 Hepatocellular carcinoma
    101281352 (PIK3R2)
   05226 Gastric cancer
    101281352 (PIK3R2)
   05214 Glioma
    101281352 (PIK3R2)
   05221 Acute myeloid leukemia
    101281352 (PIK3R2)
   05220 Chronic myeloid leukemia
    101281352 (PIK3R2)
   05218 Melanoma
    101281352 (PIK3R2)
   05211 Renal cell carcinoma
    101281352 (PIK3R2)
   05215 Prostate cancer
    101281352 (PIK3R2)
   05213 Endometrial cancer
    101281352 (PIK3R2)
   05224 Breast cancer
    101281352 (PIK3R2)
   05222 Small cell lung cancer
    101281352 (PIK3R2)
   05223 Non-small cell lung cancer
    101281352 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101281352 (PIK3R2)
   05017 Spinocerebellar ataxia
    101281352 (PIK3R2)
   05020 Prion disease
    101281352 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101281352 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101281352 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    101281352 (PIK3R2)
   04931 Insulin resistance
    101281352 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101281352 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101281352 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    101281352 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101281352 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    101281352 (PIK3R2)
   05161 Hepatitis B
    101281352 (PIK3R2)
   05160 Hepatitis C
    101281352 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    101281352 (PIK3R2)
   05164 Influenza A
    101281352 (PIK3R2)
   05162 Measles
    101281352 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    101281352 (PIK3R2)
   05163 Human cytomegalovirus infection
    101281352 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101281352 (PIK3R2)
   05169 Epstein-Barr virus infection
    101281352 (PIK3R2)
   05165 Human papillomavirus infection
    101281352 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101281352 (PIK3R2)
   05142 Chagas disease
    101281352 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101281352 (PIK3R2)
   01524 Platinum drug resistance
    101281352 (PIK3R2)
   01522 Endocrine resistance
    101281352 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101281352 (PIK3R2)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101281352 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 101281352
NCBI-ProteinID: XP_004277602
LinkDB
Position
Unknown
AA seq 723 aa
MAGAEGFQYRALYPFCRERPEDLELLPGDVLVVSRAALQALGVAEGSERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVTLARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSYRPEAPAARTDWSLNDMEQWDAAALTDGVKGFLLALPA
PLVTPEAAAEAYRALREAAGPVGPALEPPTLPLHSALTLRFLLQHLGRVARRAPALGPAV
RALSTAFGPLLLRAPSPSPPPGGAPDGTEATPDFPTLLVEKLLQEHLEEQEIAPPALPPK
PPKAKPAPTGLANGGNPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEY
TLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPV
SKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFN
ETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQE
LRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQY
SLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDT
KHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPP
ATR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggctggcgccgagggcttccaataccgtgcgttgtacccgttctgccgggagcggccg
gaggacctggagctgctgccgggcgacgtgctggtggtgagcagggcagccctgcaggcg
ctgggcgtggccgagggcagcgagcgctgcccacagagcgtgggctggatgcctggcctc
aatgagcgtacacggcagcgcggcgacttccctggcacctatgttgagttcctagggcct
gtgaccctggcccggcctgggcctcgcccacgtggcccacgcccactgcctgccaggccc
cgagatgggccccctgagccaggcctcacactccctgacctacccgagcagttctccccg
cctgatgtggctccccctatcctggtgaaacttgtggaggccattgagcggacagggcta
gacagctacaggcctgaggcacccgccgcgcgcacagactggtcgctgaacgatatggag
cagtgggacgctgcagccctaacagatggcgtgaagggcttcctgctggcgctgcccgca
ccccttgtgacacccgaggccgcggctgaggcataccgagccctgcgggaggccgcgggg
cccgtggggccagcgctggagcccccgacgctgccgctgcacagcgcgctcacactgcgc
ttcctgctccagcacctgggccgggtggcccggcgcgccccagccctgggcccagctgtg
cgtgccctgagcaccgccttcgggccgctgctgctgcgggcgccgtcgccttcgccgccg
ccagggggcgctcccgacgggactgaggccacccccgacttccctacgcttctggtggag
aagttgcttcaggaacatctggaggaacaggagattgcgcccccagcactgccgccaaaa
ccccccaaggcaaagccagcccccacaggcctggccaatgggggcaacccgccctccctg
caggatgctgagtggtactggggtgacatctccagggaggaggtaaatgagaaactgcgg
gacacacctgatggcacctttctggtccgagatgcatctagcaagatccagggggagtac
acgctgaccctcaggaaaggtgggaacaacaaactgatcaaggtcttccaccgagacggg
cactacggcttttcggagccactcaccttctgctctgtcgtggacctcatcacccactac
cgccacgagtcgctggctcagtacaacgccaagctggacacgcggctcctctacccggtg
tccaagtaccagcaggaccagatcgtcaaggaggacagtgtggaagcagtgggcgcccag
ctcaaggtctaccaccagcagtaccaggacaagagccgcgagtatgaccagctctacgag
gagtacacacgcacctcccaggaactgcagatgaagcgcacagccattgaggccttcaat
gagactatcaagatctttgaagagcagggccagacacaggagaagtgcagcaaggaatat
ctggagcgcttccggcgtgagggcaatgagaaagagatgcagaggatcctgctgaactca
gagcgacttaagtctcgcattgctgagatccacgagagccgcacaaagctggaacaggag
ctgcgggcacaggcctccgacaaccgagagattgacaagcgcatgaacagcctcaagcca
gacctcatgcagctgcgcaagatcagagaccagtacctcgtgtggctcactcagaaaggt
gcccggcagaagaaaatcaatgaatggttggggatcaagaacgagactgaggaccagtac
tcactgatggaggatgaagatgatctcccccaccacgaggaacgcacatggtatgtaggc
aagatcaaccgcacccaagctgaggaaatgctgagtggcaagcgagatggcaccttcctc
atccgtgaaagcagccagcggggctgctatgcctgttctgtggtggtggacggcgacacc
aaacactgcgtcatctaccgcacagccacgggctttggcttcgcagaaccctacaacttg
tatgggtcgctgaaggagctggtgctgcactaccagcacgcctcgctggtgcagcacaac
gacgcgctcaccgtcacacttgcccatcctgtgcgcgccccgggccccgggcccccacct
gccacccgctga

KEGG   Orcinus orca (killer whale): 101283011
Entry
101283011         CDS       T05247                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00562  Inositol phosphate metabolism
oor01100  Metabolic pathways
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05020  Prion disease
oor05100  Bacterial invasion of epithelial cells
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05142  Chagas disease
oor05146  Amoebiasis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101283011 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101283011 (PIK3CB)
   04014 Ras signaling pathway
    101283011 (PIK3CB)
   04015 Rap1 signaling pathway
    101283011 (PIK3CB)
   04370 VEGF signaling pathway
    101283011 (PIK3CB)
   04630 JAK-STAT signaling pathway
    101283011 (PIK3CB)
   04668 TNF signaling pathway
    101283011 (PIK3CB)
   04066 HIF-1 signaling pathway
    101283011 (PIK3CB)
   04068 FoxO signaling pathway
    101283011 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    101283011 (PIK3CB)
   04072 Phospholipase D signaling pathway
    101283011 (PIK3CB)
   04071 Sphingolipid signaling pathway
    101283011 (PIK3CB)
   04024 cAMP signaling pathway
    101283011 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    101283011 (PIK3CB)
   04152 AMPK signaling pathway
    101283011 (PIK3CB)
   04150 mTOR signaling pathway
    101283011 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101283011 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    101283011 (PIK3CB)
   04218 Cellular senescence
    101283011 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101283011 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    101283011 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101283011 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101283011 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    101283011 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    101283011 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    101283011 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    101283011 (PIK3CB)
   04660 T cell receptor signaling pathway
    101283011 (PIK3CB)
   04662 B cell receptor signaling pathway
    101283011 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    101283011 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    101283011 (PIK3CB)
   04670 Leukocyte transendothelial migration
    101283011 (PIK3CB)
   04062 Chemokine signaling pathway
    101283011 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101283011 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    101283011 (PIK3CB)
   04929 GnRH secretion
    101283011 (PIK3CB)
   04915 Estrogen signaling pathway
    101283011 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    101283011 (PIK3CB)
   04917 Prolactin signaling pathway
    101283011 (PIK3CB)
   04926 Relaxin signaling pathway
    101283011 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    101283011 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    101283011 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101283011 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101283011 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    101283011 (PIK3CB)
   04722 Neurotrophin signaling pathway
    101283011 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101283011 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    101283011 (PIK3CB)
   04380 Osteoclast differentiation
    101283011 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    101283011 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    101283011 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101283011 (PIK3CB)
   05206 MicroRNAs in cancer
    101283011 (PIK3CB)
   05205 Proteoglycans in cancer
    101283011 (PIK3CB)
   05203 Viral carcinogenesis
    101283011 (PIK3CB)
   05230 Central carbon metabolism in cancer
    101283011 (PIK3CB)
   05231 Choline metabolism in cancer
    101283011 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101283011 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101283011 (PIK3CB)
   05212 Pancreatic cancer
    101283011 (PIK3CB)
   05225 Hepatocellular carcinoma
    101283011 (PIK3CB)
   05226 Gastric cancer
    101283011 (PIK3CB)
   05214 Glioma
    101283011 (PIK3CB)
   05221 Acute myeloid leukemia
    101283011 (PIK3CB)
   05220 Chronic myeloid leukemia
    101283011 (PIK3CB)
   05218 Melanoma
    101283011 (PIK3CB)
   05211 Renal cell carcinoma
    101283011 (PIK3CB)
   05215 Prostate cancer
    101283011 (PIK3CB)
   05213 Endometrial cancer
    101283011 (PIK3CB)
   05224 Breast cancer
    101283011 (PIK3CB)
   05222 Small cell lung cancer
    101283011 (PIK3CB)
   05223 Non-small cell lung cancer
    101283011 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101283011 (PIK3CB)
   05017 Spinocerebellar ataxia
    101283011 (PIK3CB)
   05020 Prion disease
    101283011 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101283011 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101283011 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    101283011 (PIK3CB)
   04931 Insulin resistance
    101283011 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101283011 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101283011 (PIK3CB)
   05135 Yersinia infection
    101283011 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    101283011 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101283011 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    101283011 (PIK3CB)
   05161 Hepatitis B
    101283011 (PIK3CB)
   05160 Hepatitis C
    101283011 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    101283011 (PIK3CB)
   05164 Influenza A
    101283011 (PIK3CB)
   05162 Measles
    101283011 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    101283011 (PIK3CB)
   05163 Human cytomegalovirus infection
    101283011 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101283011 (PIK3CB)
   05169 Epstein-Barr virus infection
    101283011 (PIK3CB)
   05165 Human papillomavirus infection
    101283011 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101283011 (PIK3CB)
   05142 Chagas disease
    101283011 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101283011 (PIK3CB)
   01524 Platinum drug resistance
    101283011 (PIK3CB)
   01522 Endocrine resistance
    101283011 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101283011 (PIK3CB)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101283011 (PIK3CB)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101283011 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 101283011
NCBI-ProteinID: XP_004279014
LinkDB
Position
Unknown
AA seq 1064 aa
MPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNY
PMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGEKLDSKI
GVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKQTYPPEHEPSIPE
NLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDEVSPYDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAIEAAINR
NSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKAINPSKYQ
TIRKSGKVDYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQTNPYTE
NATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALA
NRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLKTLNSLI
KLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYIEKCKYMDSKMKPL
WLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
HSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcagacatccttgacatctgggcagtggattcacagatagcatct
gatggctccatacccgtggatttccttttgcccactgggatttatatccagttggaggta
cctcgggaagctaccatttcctatattaaacagatgttatggaaacaagttcataattac
ccaatgtttaacctccttatggaaattgactcctatatgtttgcatgtgtgaatcaaact
gctgtatatgaggagcttgaagatgaaacaagaagactctgtgatgtcagaccttttctt
ccggttctcaaattagtgacaagaagttgtgacccaggggaaaaattagactcaaaaatt
ggagtccttataggaagaggtttgcatgaatttgatgccttgaaggatcctgaggtgaat
gaattccgaataaaaatgcgcagattcagtgaggaaaagattcagtcgcttgtgggattg
tcttggatggattggctaaagcaaacctatccaccagagcatgaaccatccatccctgaa
aatctagaagataaactttacggaggaaagctcattgtggctgttcattttgaaaattgt
caggatgtgtttagctttcaagtatctcctaatatgaatcctatcaaaataaatgaattg
gcaatccaaaaacgtttgactattcatgggaaagaagatgaagttagcccctatgactat
gtgttgcaagtcagtgggagagtagaatatgtgtttggtgatcacccactaattcagttc
cagtatatccggaactgtgtgatgaataggaccttgccccattttatacttgtggaatgt
tgcaagatcaagaagctgtatgaacaggaaatgattgccatagaggctgccataaatcga
aattcatctaaccttcctcttcctttaccaccaaagaaaactcgaattatttctcatgtt
tgggaaaataacaaccctttccaaattgtcttggttaagggaaataaacttaatacagaa
gaaactgtaaaagttcatgtcagggctggcctttttcatggtaccgaactcctgtgtaaa
accatcgtaagctcagagatatcagggaaaaacgatcatatttggaatgaaccactggaa
tttgatatcaatacttgtgacctgccacgaatggctcgattatgtttcgctgtttatgca
gttttggataaagtgaaaacgaagaaatcaactaaagctattaatccctctaaatatcag
accatcaggaaatctggaaaagtggattatcctgtagcctgggtaaatacgatggttttt
gactttaaaggacagttgagatctggagatataatattgcacagctggtcttcatttcct
gatgaacttgaagaaatgttgaatccaatgggaactgttcaaacaaatccatatactgaa
aatgcaacagctttgcacatcagattcccagagaataaaaaacaaccttattactatcct
ccctttgataagattattgaaaaggcagctgagattgcaagcagtgatagtgctaatgta
tcaagtcgaggtggaaagaagtttcttgctgtactgaaagaaatcttggacagggatccg
ttgtctcagctgtgtgagaatgaaatggatcttatttggactttgcgacaagactgcaga
gagaatttcccacagtcattgccaaaattactgctgtcaatcaagtggaataaacttgag
gatgttgctcagcttcaggcactacttcagatttggcctaaactgcccccccgggaggcc
ctggagcttctagatttcaactatccagatcagtacgtgcgagaatatgctgtgggctgt
ctgcaacagatgagtgatgaagaactctctcaatatcttttacagttggtgcaagtttta
aaatatgagccttttcttgattgtgccctctctagattcctactagaaagagcacttgct
aatcggaggatagggcagtttttattttggcaccttaggtcagaagtgcacattcctgct
gtttcagtacaatttggtgtcatccttgaagcatactgccggggaagtgtaggtcacatg
aaagcgctttccaagcaggttgaagcactcaataaattaaaaactttaaatagtttaatc
aaactgaatgcaatgaagctaaatagagccaaagggaaagaagcaatgcacacttgttta
aaacagaatgcttatcgggaagccctctctgacctgcaatcacctctgaacccatgtgtt
atcctctcagaactctatattgaaaagtgtaaatacatggattccaaaatgaagcctttg
tggctggtgtacaacaacaaggtgtttggtgaggattcagttggagtgatttttaaaaat
ggtgatgatttacggcaggatatgttgacactccaaatgctgcgcttgatggatttactc
tggaaagaagctggtctggatcttaggatgctgccttatggctgtttagcaacaggagac
cactctggcctcattgaagttgtgagcacctctgaaacaattgctgacattcagctgaac
agtagcaatgtggctgcagcagcagccttcaacaaagatgcccttctgaactggcttaaa
gaatacaattctggggatgacctggaccgagccattgaggagtttaccctgtcctgtgcc
ggctactgtgtagcttcttatgtccttgggattggtgacagacatagtgataacatcatg
gtcaaaaaaactggccagctcttccacattgactttggacatattcttggaaatttcaag
tctaaatttggcattaaaagggagagagtgccttttattcttacctatgatttcattcat
gtgattcaacaaggaaaaacaggaaacacggaaaagtttggccggttccgccagtgttgt
gaggatgcatatctgattttacgacggcatgggaatctcttcatcactctctttgcactg
atgttgactgcagggcttcctgagctcacatcagtcaaggatatacagtatcttaaggac
tctcttgccttagggaagagtgaagaagaagcactcaagcaatttaagcaaaaatttgat
gaggcactcagggaaagctggactactaaagtgaactggatggcccacacagttcggaaa
gactacagatcttaa

KEGG   Orcinus orca (killer whale): 101285437
Entry
101285437         CDS       T05247                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04070  Phosphatidylinositol signaling system
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04360  Axon guidance
oor04370  VEGF signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04611  Platelet activation
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04670  Leukocyte transendothelial migration
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04923  Regulation of lipolysis in adipocytes
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor04960  Aldosterone-regulated sodium reabsorption
oor04973  Carbohydrate digestion and absorption
oor05010  Alzheimer disease
oor05017  Spinocerebellar ataxia
oor05020  Prion disease
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05142  Chagas disease
oor05146  Amoebiasis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05171  Coronavirus disease - COVID-19
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101285437 (PIK3R1)
   04014 Ras signaling pathway
    101285437 (PIK3R1)
   04015 Rap1 signaling pathway
    101285437 (PIK3R1)
   04370 VEGF signaling pathway
    101285437 (PIK3R1)
   04630 JAK-STAT signaling pathway
    101285437 (PIK3R1)
   04668 TNF signaling pathway
    101285437 (PIK3R1)
   04066 HIF-1 signaling pathway
    101285437 (PIK3R1)
   04068 FoxO signaling pathway
    101285437 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    101285437 (PIK3R1)
   04072 Phospholipase D signaling pathway
    101285437 (PIK3R1)
   04071 Sphingolipid signaling pathway
    101285437 (PIK3R1)
   04024 cAMP signaling pathway
    101285437 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    101285437 (PIK3R1)
   04152 AMPK signaling pathway
    101285437 (PIK3R1)
   04150 mTOR signaling pathway
    101285437 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101285437 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    101285437 (PIK3R1)
   04218 Cellular senescence
    101285437 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101285437 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101285437 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101285437 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101285437 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    101285437 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    101285437 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    101285437 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    101285437 (PIK3R1)
   04660 T cell receptor signaling pathway
    101285437 (PIK3R1)
   04662 B cell receptor signaling pathway
    101285437 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    101285437 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    101285437 (PIK3R1)
   04670 Leukocyte transendothelial migration
    101285437 (PIK3R1)
   04062 Chemokine signaling pathway
    101285437 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101285437 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    101285437 (PIK3R1)
   04929 GnRH secretion
    101285437 (PIK3R1)
   04915 Estrogen signaling pathway
    101285437 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    101285437 (PIK3R1)
   04917 Prolactin signaling pathway
    101285437 (PIK3R1)
   04926 Relaxin signaling pathway
    101285437 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    101285437 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    101285437 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101285437 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101285437 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    101285437 (PIK3R1)
   04722 Neurotrophin signaling pathway
    101285437 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101285437 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    101285437 (PIK3R1)
   04380 Osteoclast differentiation
    101285437 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    101285437 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    101285437 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101285437 (PIK3R1)
   05206 MicroRNAs in cancer
    101285437 (PIK3R1)
   05205 Proteoglycans in cancer
    101285437 (PIK3R1)
   05203 Viral carcinogenesis
    101285437 (PIK3R1)
   05230 Central carbon metabolism in cancer
    101285437 (PIK3R1)
   05231 Choline metabolism in cancer
    101285437 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101285437 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101285437 (PIK3R1)
   05212 Pancreatic cancer
    101285437 (PIK3R1)
   05225 Hepatocellular carcinoma
    101285437 (PIK3R1)
   05226 Gastric cancer
    101285437 (PIK3R1)
   05214 Glioma
    101285437 (PIK3R1)
   05221 Acute myeloid leukemia
    101285437 (PIK3R1)
   05220 Chronic myeloid leukemia
    101285437 (PIK3R1)
   05218 Melanoma
    101285437 (PIK3R1)
   05211 Renal cell carcinoma
    101285437 (PIK3R1)
   05215 Prostate cancer
    101285437 (PIK3R1)
   05213 Endometrial cancer
    101285437 (PIK3R1)
   05224 Breast cancer
    101285437 (PIK3R1)
   05222 Small cell lung cancer
    101285437 (PIK3R1)
   05223 Non-small cell lung cancer
    101285437 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101285437 (PIK3R1)
   05017 Spinocerebellar ataxia
    101285437 (PIK3R1)
   05020 Prion disease
    101285437 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101285437 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101285437 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    101285437 (PIK3R1)
   04931 Insulin resistance
    101285437 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101285437 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101285437 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    101285437 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101285437 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    101285437 (PIK3R1)
   05161 Hepatitis B
    101285437 (PIK3R1)
   05160 Hepatitis C
    101285437 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    101285437 (PIK3R1)
   05164 Influenza A
    101285437 (PIK3R1)
   05162 Measles
    101285437 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    101285437 (PIK3R1)
   05163 Human cytomegalovirus infection
    101285437 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101285437 (PIK3R1)
   05169 Epstein-Barr virus infection
    101285437 (PIK3R1)
   05165 Human papillomavirus infection
    101285437 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101285437 (PIK3R1)
   05142 Chagas disease
    101285437 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101285437 (PIK3R1)
   01524 Platinum drug resistance
    101285437 (PIK3R1)
   01522 Endocrine resistance
    101285437 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101285437 (PIK3R1)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101285437 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 DUF4201 Laminin_I Lant_dehydr_C PI_PP_I Mod_r
Other DBs
NCBI-GeneID: 101285437
NCBI-ProteinID: XP_004270815
LinkDB
Position
Unknown
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADSEQQASTLPDLAE
QFAPPDVAPPLLVKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLLDLPNPVIPVAIYNEMVSLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLCQTSSKNLLNARVLSELFSPLLFRFPAASSENPEHLIKVIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagcgccgaggggtaccagtacagggcgctgtacgactataagaaggagcgggaagaa
gacattgacttgcacttgggggacgtactgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaagaagccaggcctgaagaaatcggctggttaaatggctataac
gagaccactggggagaggggggactttccgggaacttacgtagaatacattggaaggaaa
aagatctcaccgcccacaccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcgaaaactgaagcagacagtgagcagcaagcttcgactcttccagaccttgcagag
cagttcgcccctcctgacgttgctccaccgcttcttgtcaagctagtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagcagaa
ttacgacagcttcttgattgtgatgctgcctccgtggacttggaaatgatcgatgtgcac
gttttagcagacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagtt
gccatttacaatgaaatggtttctttagccccagaagtgcaaagctctgaagaatacatc
cagctgttgaagaagctcattaggtcgcccagcatacctcatcagtactggctcacgctg
cagtatttgctaaaacatttcttcaagctctgtcaaacgtccagcaaaaatcttttgaat
gcaagagtactctctgaactcttcagccccctgcttttcagattcccagcagccagttct
gagaatcctgaacacctcataaaagttatagaaattttaatctccaccgaatggaatgaa
cgccagcctgcaccagcactgcctcctaaaccaccaaaacccactactgtagcgaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatttcgagg
gaagaagtgaatgaaaaacttcgagatacagctgatgggacctttttggtacgagacgca
tctactaaaatgcacggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaactgataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggagtatgatagattatatgaagattatacccgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacc
caggagcggtacagcaaagaatacatagaaaagtttaaacgcgaaggcaatgagaaagaa
atccaaaggattatgcataactatgaaaagttaaagtctcgcatcagtgaaattgtcgac
agcagaaggagattggaggaggacttgaagaagcaggctgccgagtatcgtgagatcgac
aaacggatgaacagcattaaaccagacctcattcagctgagaaagacaagagaccaatac
ttgatgtggttgactcagaaaggtgttcggcagaagaagctgaacgagtggctgggcaat
gaaaacaccgaagaccaatattcgctggtggaagatgacgaggatttgccccaccacgac
gagaagacgtggaacgttggcagcagcaaccgaaacaaagccgaaaacctgttgcgaggg
aaacgagatggcacttttctggtccgggagagcagtaaacagggctgctacgcgtgctcc
gtagtggtggacggtgaggtcaagcactgcgtcatcaacaagacggccacgggctacggc
ttcgccgagccctacaacctgtacagctccctgaaggaactggtgctccactaccaacac
acgtccctcgtgcagcacaacgactccctcaacgtcacgctagcctacccggtgtacgcg
cagcagcggcgatga

DBGET integrated database retrieval system