KEGG   Orcinus orca (killer whale): 101277587
Entry
101277587         CDS       T05247                                 

Definition
(RefSeq) kit ligand-like isoform X1
  KO
K05461  KIT ligand
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04072  Phospholipase D signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04640  Hematopoietic cell lineage
oor04916  Melanogenesis
oor05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101277587
   04014 Ras signaling pathway
    101277587
   04015 Rap1 signaling pathway
    101277587
   04072 Phospholipase D signaling pathway
    101277587
   04151 PI3K-Akt signaling pathway
    101277587
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101277587
  09152 Endocrine system
   04916 Melanogenesis
    101277587
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101277587
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101277587
Cytokines and growth factors [BR:oor04052]
 Growth factors
  Growth factors (RTK binding)
   101277587
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 101277587
NCBI-ProteinID: XP_004271852
LinkDB
Position
Unknown
AA seq 274 aa
MKKTETWIITCIYLQLLLFNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLRYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRLFTPEKFFGIFNKSIDAFKDLKMVASKTSECVMSSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIEDSSLQWAAVALPAFFSLIIGFAVGALYWKK
KQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacagaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctcagatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacctaggctgtttactcctgaaaaattc
tttggaatttttaataaatccatcgatgccttcaaggacttgaagatggtggcttctaaa
actagtgaatgtgtgatgtcttcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagc
agtaataggaaggcctcaaatcctattgaagactccagcctacaatgggcagccgtagca
ttgccggcattcttttctcttataattgggtttgctgttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system