KEGG   Orcinus orca (killer whale): 101277714
Entry
101277714         CDS       T05247                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04390  Hippo signaling pathway
oor04810  Regulation of actin cytoskeleton
oor05200  Pathways in cancer
oor05218  Melanoma
oor05224  Breast cancer
oor05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101277714 (FGF1)
   04014 Ras signaling pathway
    101277714 (FGF1)
   04015 Rap1 signaling pathway
    101277714 (FGF1)
   04390 Hippo signaling pathway
    101277714 (FGF1)
   04151 PI3K-Akt signaling pathway
    101277714 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101277714 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101277714 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101277714 (FGF1)
   05218 Melanoma
    101277714 (FGF1)
   05224 Breast cancer
    101277714 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101277714 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101277714 (FGF1)
Cytokines and growth factors [BR:oor04052]
 Growth factors
  Growth factors (RTK binding)
   101277714 (FGF1)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101277714 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101277714
NCBI-ProteinID: XP_004280268
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYASKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacaagggacaggagtgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtacggagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacacccaatgaggaatgtttgttc
ctggaaaggttggaggaaaaccattacaacacctacgcatccaagaagcatgcagaaaag
aattggttcgttggtctcaagaagaacggaagctgcaaacgcggtcctcggactcactac
ggccagaaagcaatcttgtttctccccctgccggtctcctccgattaa

DBGET integrated database retrieval system