KEGG   Orcinus orca (killer whale): 101278085Help
Entry
101278085         CDS       T05247                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00020  Citrate cycle (TCA cycle)
oor00190  Oxidative phosphorylation
oor01100  Metabolic pathways
oor01200  Carbon metabolism
oor04714  Thermogenesis
oor04932  Non-alcoholic fatty liver disease (NAFLD)
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05016  Huntington disease
Module
oor_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oor_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101278085 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101278085 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101278085 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101278085 (SDHB)
   05012 Parkinson disease
    101278085 (SDHB)
   05016 Huntington disease
    101278085 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101278085 (SDHB)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101278085 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101278085
NCBI-ProteinID: XP_004272500
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVAVSLRRRFQATTLGRACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDIN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKKQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTNSCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggttgcagtctccttgaggcgccggttccaggccacaacccttggcaga
gcctgcctgcaggcctgccgtggggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctatcgatgggacccagacaagactggagataaacctcatatgcaaact
tacgaaattgatttgaataactgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcgtgcagagaaggcatctgcggctcc
tgtgccatgaacatcaatggaggcaacactctcgcttgtacccgaaggattgacatcaac
ctcaacaaagtttccaaaatctaccctcttccacatatgtatgtgataaaggatcttgtt
cctgatttgagcaacttctatgcccagtacaagtccattgagccttatttaaagaagaag
gatgaatcccaggaaggcaagaagcagtatctgcagtccatagaagatcgtgagaaactg
gacgggctctatgagtgcattctctgcgcctgctgcagcaccagctgcccgagctactgg
tggaatggagacaagtacttgggacccgcagttcttatgcaggcctatcgctggatgatc
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacgaattcctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcaacctataaggaaaagaaagcttcagct
taa

DBGET integrated database retrieval system