KEGG   Orcinus orca (killer whale): 101278129Help
Entry
101278129         CDS       T05247                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04061  Viral protein interaction with cytokine and cytokine receptor
oor04062  Chemokine signaling pathway
oor04064  NF-kappa B signaling pathway
oor04072  Phospholipase D signaling pathway
oor04218  Cellular senescence
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04932  Non-alcoholic fatty liver disease (NAFLD)
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05132  Salmonella infection
oor05133  Pertussis
oor05134  Legionellosis
oor05135  Yersinia infection
oor05142  Chagas disease (American trypanosomiasis)
oor05144  Malaria
oor05146  Amoebiasis
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05219  Bladder cancer
oor05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101278129 (CXCL8)
   04072 Phospholipase D signaling pathway
    101278129 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101278129 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101278129 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101278129 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101278129 (CXCL8)
   04621 NOD-like receptor signaling pathway
    101278129 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    101278129 (CXCL8)
   04657 IL-17 signaling pathway
    101278129 (CXCL8)
   04062 Chemokine signaling pathway
    101278129 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101278129 (CXCL8)
   05202 Transcriptional misregulation in cancer
    101278129 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    101278129 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101278129 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101278129 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101278129 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101278129 (CXCL8)
   05135 Yersinia infection
    101278129 (CXCL8)
   05133 Pertussis
    101278129 (CXCL8)
   05134 Legionellosis
    101278129 (CXCL8)
  09172 Infectious disease: viral
   05164 Influenza A
    101278129 (CXCL8)
   05161 Hepatitis B
    101278129 (CXCL8)
   05163 Human cytomegalovirus infection
    101278129 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101278129 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101278129 (CXCL8)
   05144 Malaria
    101278129 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    101278129 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101278129 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101278129 (CXCL8)
Cytokines and growth factors [BR:oor04052]
 Cytokines
  Chemokines
   101278129 (CXCL8)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Haparin
  Chemokines
   101278129 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 DUF5527
Motif
Other DBs
NCBI-GeneID: 101278129
NCBI-ProteinID: XP_004283602
LinkDB All DBs
Position
Unknown
AA seq 101 aa AA seqDB search
MTSKLAIALLAAFLLSAALCKAAVLSRMTSELRCQCINIHSTPFHPKFIRELRVIESGPH
CENSEIIVKLVNGKEVCLNPKEKWVQKVVQIFLKRAEKKDP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggctattgctctcttggcagccttcctgctttctgcagctctgtgt
aaagctgcagttctatcaagaatgacctcagaacttcgatgccaatgcataaatatacac
tccacacctttccaccccaaatttatcagagaattgcgagtgattgagagtggaccacac
tgtgaaaattcagaaatcattgttaagcttgtcaatggaaaagaggtctgcttaaacccc
aaggaaaagtgggtgcagaaggttgtgcagatatttttgaagagagctgagaagaaagat
ccatga

DBGET integrated database retrieval system