KEGG   Orcinus orca (killer whale): 101278172Help
Entry
101278172         CDS       T05247                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7 isoform X1
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor05034  Alcoholism
oor05165  Human papillomavirus infection
oor05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    101278172 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    101278172 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    101278172 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101278172 (HDAC7)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101278172 (HDAC7)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101278172 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101278172
NCBI-ProteinID: XP_012390132
LinkDB All DBs
Position
Unknown
AA seq 1030 aa AA seqDB search
MHSPGADGTQVSPGAHCPSPPGTGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLA
LQHPQRLHHHLFLAGLQTQRSAETMRVKIELPKHAVASSSDPAPLPPFSLPRPSPPSPTP
RPSLGGRPSPQLSMDTPLPELQVGQQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKK
QQAALERTVHPNSPSVPYRTLEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSE
PNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSE
HGPNPVLGSEALLGQRLRLQETSLAPFALLPTITLGLPAPARADGDRRTHATLGPRGPVL
ASPHAPLFLPHGLEPEAGGPLPSRLQPILLLDPSVSHAPLLTVPGLGPLPFHFAQSLLTT
ERPSGSGLHRPLSRTRSEPLPPSATAPPLLGPLQPRLERLKPHVQLMKRPAKPSEKPRLQ
QIPSAEDLETDGGGVGPLGDDGLEHRESSHGQHEARGPVPLQQHQQVYLWEQQRLAGRLP
RGATGDSVLPPLAQGGHRPLSRAQSSPAAPASLPTPEPTSQARVLPSSETPARTLPFTTG
LVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLLERGLRSQCESLRGRKASLEELQSVH
SERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWA
AGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKI
LIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAW
AGGLDPPVGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPPPLGGYHVSAKCFG
YMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAI
RSLEAVIRVHSEYWGCMQRLASCPDSWVPRVPGADAEVEAVTALASLSVGILTEERTSEQ
LVEEEEPMNL
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactgccccagtccc
cctggcacaggctgccccaggccctgcgcagacacgccaggccctcagccccagcccatg
gacctgcgggtgggccagcggcccccggtggagcccccgccggagcccacgctgctggcc
ctgcagcacccccagcgcctgcaccaccacctcttcctggctggcctgcagacccagcgc
tcggcggagaccatgagggtaaagatagagctccccaagcacgcagtggcctcgagctca
gacccggcacccctccctcccttcagcctccccagaccctcgcctccgtctccaactcct
cgcccctccctgggcggccggccctccccacagctctcaatggacacgccgttgcccgag
ttgcaggtggggcagcaggagcaggagctgcggcagcttctcaataaggacaagagcaag
cgcagtgccgtagccagcagtgtggtcaagcagaagctggcagaggtgattctgaagaaa
cagcaggcagccttagagaggacggtccatcccaatagccccagcgttccctacagaact
cttgagcccttggagacggaaggagctgcccgttccatgctcagcagcttcctgcctcct
gtacccagcctgcccagcgaccccccagaacacttccctctgcgtaagacagtctctgag
cccaacctgaagctgcgctacaagcccaaaaagtccctggagcggaggaagaacccgctg
ctgcggaaggagagcgccccgcccagcctccggcggcggccggcagagaccctcggcgac
tcctcccccagtagtagcagcacgccggcgtcagggtgcagctcccccaatgacagcgag
cacggccccaacccggtcctgggctccgaggcgctcttgggccagcggctgcggctgcag
gagacctctctggctccgttcgccttgctgcccacaatcacgctggggctgcctgcccct
gccagggctgatggtgaccgcaggacccatgcgactctgggccctcggggaccagtcctg
gcgagtccccatgctcccctcttcctgccccatggcctggagcccgaggctggaggcccc
ctgccctctcgcctgcagcccattctcctcctggatccttcggtctctcacgcccccctg
ctgactgtgcccgggcttgggcccctgcccttccactttgcccagtccttactgaccacc
gagcggccctccgggtcaggcctccaccggccgctgagccggacccgctcagagcccctg
cccccaagcgccactgcccccccactgctgggtcccctgcagccccgcctggagcggctc
aaacctcatgtccagctgatgaagaggccagccaagccgagtgagaagccccgactgcag
cagataccctcggctgaggacctcgagacagatggcgggggcgtggggccgctgggggat
gacggcctggagcacagggagtccagccatgggcagcatgaggcccgaggccctgttcct
ctccagcagcaccagcaggtgtacctctgggagcagcagcgactggctgggcggctcccc
cggggagccactggggactccgtgctgcctcccctggcccagggcggtcaccggcctctg
tccagggctcagtcttccccagccgcgcctgcctccctgccaaccccagagcccaccagc
caggcccgtgtcctgcccagctcagagacccctgcccggaccctgcccttcaccacaggg
ctggtctatgactcagtaatgctgaagcaccagtgctcctgcggagacaacagccggcac
ccggagcacgcaggccgcatccagagcatctggtcccggctgctggagcgggggctccgg
agccagtgcgagtctctacggggccggaaggcctccctggaggagctgcagtcagtgcac
tcggagaggcacgtgctcctctacggcaccaacccgctcagccgcctcaaactggacaat
gggaagctggcagggctcctggcacagcggatgttcgtgatgctgccctgcggtggcgtt
ggggtggataccgacaccatctggaacgagctgcactcctccaacgcggcccgctgggct
gccggcagcgtcactgacctcgccttcaaagtggcttcccgagagctaaagaacggtttt
gctgtggttcggcccccaggacaccatgcagaccattccacagccatgggcttctgcttc
ttcaactcagtggccatcgcctgccggcagctgcaacaacagggcaaggccagcaagatc
ctcatcgtggactgggacgttcaccatggcaacggcacacagcagaccttctaccaggac
cccagcgtgctctacatctcccttcatcgccacgacgatggcaacttcttcccaggcagt
ggggctgtggatgaggtgggagctggcagcggtgagggcttcaatgtcaatgtggcctgg
gctggaggtctggaccccccagtgggggatcctgagtacctggccgccttcaggatagtc
gtgatgcccatcgcccgggagttctctccggacctggtcctggtgtcagctgggtttgat
gctgccgagggtcacccacccccactgggcggctaccacgtttccgccaaatgttttggg
tacatgacgcagcagctgatgagcctggcgggaggcgcggtggtgctggccttggagggt
ggccacgatctcacagccatctgtgacgcctctgaggcctgtgtggctgctcttctaggc
aacaaggtggatcccctctcagaagaaggctggaaacagaaacccaacctcaatgccatc
cgctctctggaagctgtgatccgggtgcacagtgaatactggggctgcatgcagcgcctg
gcctcctgtccagactcctgggtgcccagggtgccaggggccgatgcagaagtggaggca
gtaactgcactggcatccctctccgtgggcatcctgactgaagagcggacctcagagcag
ctggtggaggaggaagaacccatgaatctttag

DBGET integrated database retrieval system