KEGG   Orcinus orca (killer whale): 101278548
Entry
101278548         CDS       T05247                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04014  Ras signaling pathway
oor04390  Hippo signaling pathway
oor04392  Hippo signaling pathway - multiple species
oor05200  Pathways in cancer
oor05206  MicroRNAs in cancer
oor05219  Bladder cancer
oor05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101278548 (RASSF1)
   04390 Hippo signaling pathway
    101278548 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    101278548 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101278548 (RASSF1)
   05206 MicroRNAs in cancer
    101278548 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101278548 (RASSF1)
   05223 Non-small cell lung cancer
    101278548 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 101278548
NCBI-ProteinID: XP_004267884
LinkDB
Position
Unknown
AA seq 340 aa
MSAEPELIELRDLAPARCAAPGRTRLERANALRIAPGTARNAARQLVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVD
EPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASK
KPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtccgctgagcctgagctcattgagctgcgggacctggcacccgcgcggtgcgccgcc
ccgggccgcacccggcttgagcgtgccaacgcgctgcgcatcgcgccgggcacagcgcgc
aacgccgcaaggcagctggtcccaggccgcggccaccgcttccagcccgcggggcccact
acgcacacatggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcacattgcaagttcacctgccactaccgttgccgcgcgctcgtctgcctagac
tgctgcggaccccgggacctgggctgggaaccggcgctggagcgggacacgaatgtggat
gagcccgtggagtgggagacacctgacctttctcaggctgagattgagcagaagatcaag
gagtacaatggccagatcaacagcaacttgttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcaactgaagctggtgcgccctgtctcagttcccgccagcaag
aagccaccctccttgcaggatgcccggcggggcccagggcggggtacagctgtgaaacgc
cgcacctccttctacctgcccaaggatgctgtcaagcacctgcatgtcttgtcacgcaca
cgggcacgcgaggtcatcgaggccctgctgcgcaagttcttggtggtggatgacccccgc
aagtttgcactttttgagcgggctgagcgccatggccaagtgtacctccggaagctgtca
gatgatgagcagcccctacggctacggctccttgcagggcccagtgagaaggccctaagc
tttgtcctgaaggagaatgactctggggaggtgaactgggatgctttcagcatgcctgag
ctacacaacttcctacgcatcctgcagcgggaggaagaggaacatctccgccagatcctg
cagaagtactcgtattgccgccagaagatccaggaagccctgcatgcctgccccctgggg
tga

DBGET integrated database retrieval system