KEGG   Orcinus orca (killer whale): 101278979
Entry
101278979         CDS       T05247                                 

Gene name
ROCK1
Definition
(RefSeq) LOW QUALITY PROTEIN: rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04071  Sphingolipid signaling pathway
oor04270  Vascular smooth muscle contraction
oor04350  TGF-beta signaling pathway
oor04360  Axon guidance
oor04510  Focal adhesion
oor04530  Tight junction
oor04611  Platelet activation
oor04670  Leukocyte transendothelial migration
oor04810  Regulation of actin cytoskeleton
oor04921  Oxytocin signaling pathway
oor05135  Yersinia infection
oor05163  Human cytomegalovirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101278979 (ROCK1)
   04071 Sphingolipid signaling pathway
    101278979 (ROCK1)
   04024 cAMP signaling pathway
    101278979 (ROCK1)
   04022 cGMP-PKG signaling pathway
    101278979 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101278979 (ROCK1)
   04530 Tight junction
    101278979 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101278979 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101278979 (ROCK1)
   04670 Leukocyte transendothelial migration
    101278979 (ROCK1)
   04062 Chemokine signaling pathway
    101278979 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101278979 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101278979 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    101278979 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101278979 (ROCK1)
   05206 MicroRNAs in cancer
    101278979 (ROCK1)
   05205 Proteoglycans in cancer
    101278979 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101278979 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101278979 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101278979 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101278979 (ROCK1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101278979 (ROCK1)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101278979 (ROCK1)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101278979 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil HR1 Pkinase_C DUF1192 APH
Other DBs
NCBI-GeneID: 101278979
NCBI-ProteinID: XP_004273814
LinkDB
Position
Unknown
AA seq 1351 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGGNRQANEEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDRXIILTWNTYSKEIFKKGQWNFCNNYVEPVAPVVPDLSSDI
DTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNENRTSSNVDKS
LQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQ
IEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSHLANEKLAQL
QKQLEEANDLLRTESDTAVRLRKSHTEMSKSITQLESLNRELQERNRILENSKSQMDKDY
YQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLNHSE
KEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKLKEE
REAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLSLQLEQESNKR
LLLQNELKTHAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMRELQ
DQLEAEQYFSTLYKTQVKELKEEIEEKNRENSKKIQELQSEKETLATQLDLAETKAESEQ
LARGLLEEQYFELTQESKKAASRNRQEITDKEHTVSRLEETNSMLTKDIELLRKENEELT
DKMRKAEEEYKLKKEEEINNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKAN
TQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQLASK
ESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKKQYV
VVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANE
GECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRR
CHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSG
FVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4056 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgctaacagtccatgggtcgttcagctattt
tatgcattccaagatgatcgttatctctacatggtaatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcccgattttatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgataacatgctgctggataagtctggacatttgaagttagcagactttgggggaaac
agacaggcaaatgaggaaggtatggtacgatgtgatacagcagttgggacacctgattat
atttcccctgaagtattaaaatctcaaggtggtgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacaccattttatgca
gattctctggttggaacttacagtaagattatgaaccataaaaattcacttaccttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacagg
taaataattttaacatggaacacttattccaaggaaattttcaaaaaaggacagtggaat
ttttgtaacaattatgttgaacctgtagcgccagttgtacctgatttaagtagtgacatt
gacacaagtaactttgatgacttggaagaagataaaggagatgaagaaacattccctata
cctaaagcttttgttggcaatcaactaccctttgtaggatttacgtattatagcaatcgt
agatacttatcttcagcaaatcctaatgaaaacagaactagctctaatgtggataaaagc
ttgcaggaaaatttgcaaaaaacaatttataagctggaagaacagttgcataatgaaatg
cagttaaaagatgaaatggagcagaagtgcagaacttcaaacataaaactcgacaagata
atgaaagaattggatgaagaggggaatcaaagaagaaacctagaatctacagtgtctcag
attgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaagaaaagcagaa
caggaaaatgagaagaggaggaatgtagaaaatgaagtttctacattaaaggatcagttg
gaagacttaaagaaagtcagtcagaattcacaccttgctaatgagaagctggcacaatta
caaaagcagctagaagaagccaatgacttacttaggacagaatcagacacagctgtaaga
ttaaggaagagtcacaccgagatgagtaaatcaattactcagctagagtccctgaataga
gaattgcaggagagaaatagaattttggagaattccaagtcacaaatggacaaggattat
taccagctgcaagctgtattagaagctgaacgaagggacagaggtcatgattctgagatg
attggagacctacaagctcgaattacatctttacaagaggaggtgaagcatctcaaacat
aatcttgaaagagtggaaggagaaagaaaagaggctcaagacatgcttaatcattcagaa
aaggaaaagaataacttagaaatagatttaaactacaagcttaaatcattacagcaaagg
ttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgacaaacatcaa
tctattgaagaggccaagtctgttgcaatgtgtgagatggaaaaaaagctgaaggaagag
agagaagctcgagagaaggctgaaaatagggttgttcagattgagaagcaatgctccatg
ctagatgttgatctaaaacaatctcagcagaagctagagcatttgactgaaaataaagaa
aggatggaggatgaagttaagaatctatccctgcaactggagcaggagtcaaataagcga
ctgttgttacaaaatgaattgaagacccacgcatttgaggcagacaatttaaaaggttta
gaaaagcagatgaaacaggaaataaatactttattggaagcaaagagattattagagttt
gaattagctcagcttacaaaacaatacagaggaaatgaaggacagatgcgggagctacaa
gatcagcttgaagctgagcaatatttctcgacactttataaaacccaggtaaaggaactt
aaggaagaaattgaagaaaaaaacagagaaaattcaaagaaaatacaggaactacaaagt
gaaaaagaaactcttgctactcagttggatctagcagaaacaaaagccgagtctgagcag
ttggctcgagggcttctggaagaacagtattttgaattgacccaagaaagcaagaaagct
gcttcaagaaatagacaagagattacagataaagagcacactgttagtcggctcgaagaa
acgaacagtatgctaaccaaagatattgaattattaagaaaagaaaatgaagagctaact
gataaaatgaggaaggcagaggaagaatataaactgaagaaggaggaggagatcaataat
cttaaggctgcctttgaaaagaatatcaatacagaacgaacccttaaaacgcaggctgtt
aacaagttggcagaaataatgaatcggaaagactttaaaattgatagaaagaaagctaat
acacaggatttgagaaagaaggaaaaggaaaatcgaaagctacaacttgaactcaaccaa
gaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaatgacatgcaa
gcgcaattggtagaagaatgtacacataggaatgagcttcagatgcagttggctagcaaa
gagagtgacattgagcaattgcgtgcgaaacttttggacctatcagattctacaagtgtt
gctagttttcctagtgctgatgaaactgatggaaaccttccagaatcaagaattgaaggt
tggctttcaataccaaatagaggaaatatcaaaagatacggctggaagaaacagtatgtt
gtggtaagcagcaaaaaaattttgttttataatgatgaacaagataaggaacaatccaat
ccatctatggtattggacattgataaattgtttcatgttcgtcctgtaacccaaggagat
gtgtacagagctgaaactgaagaaattcctaaaatattccagatactatacgcaaatgaa
ggtgaatgtagaaaagacgtagagatggaaccagtgcaacaagctgagaaaactaatttt
caaaaccacaaaggtcatgagttcattcctaccctctaccactttcccgccaactgtgag
gcctgtgccaaaccgctctggcatgtttttaagccaccccctgccctggaatgtcgaagg
tgccacgttaagtgccacagagatcacttagataagaaagaggacttaatttctccatgt
aaagtaagttatgatgtaacatcagcaagagatatgctgctactagcatgttctcaggat
gaacaaaaaaaatgggtaactcatttagtaaagaagattcctaagaatccaccatctggt
tttgttcgtgcgtcgcctcgaacactttctacaagatccactgcaaatcagtctttccgg
aaagtggtcaaaaatacatctggaaaaactagttaa

KEGG   Orcinus orca (killer whale): 101289250
Entry
101289250         CDS       T05247                                 

Gene name
ROCK2
Definition
(RefSeq) rho-associated protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04071  Sphingolipid signaling pathway
oor04270  Vascular smooth muscle contraction
oor04310  Wnt signaling pathway
oor04360  Axon guidance
oor04510  Focal adhesion
oor04530  Tight junction
oor04611  Platelet activation
oor04670  Leukocyte transendothelial migration
oor04810  Regulation of actin cytoskeleton
oor04921  Oxytocin signaling pathway
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05163  Human cytomegalovirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101289250 (ROCK2)
   04071 Sphingolipid signaling pathway
    101289250 (ROCK2)
   04024 cAMP signaling pathway
    101289250 (ROCK2)
   04022 cGMP-PKG signaling pathway
    101289250 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101289250 (ROCK2)
   04530 Tight junction
    101289250 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101289250 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101289250 (ROCK2)
   04670 Leukocyte transendothelial migration
    101289250 (ROCK2)
   04062 Chemokine signaling pathway
    101289250 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101289250 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101289250 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    101289250 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101289250 (ROCK2)
   05205 Proteoglycans in cancer
    101289250 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101289250 (ROCK2)
   05135 Yersinia infection
    101289250 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101289250 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101289250 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101289250 (ROCK2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101289250 (ROCK2)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101289250 (ROCK2)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101289250 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 101289250
NCBI-ProteinID: XP_004274926
LinkDB
Position
Unknown
AA seq 1388 aa
MSRPPPTGKMPGAPEAVSGDGAGVSRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCKENDSIQSRKNEESQEIQKKLYTLEEHLSSEIQAKEELEQKCKSVNTRLEKV
AKELEEEITLRKNVESALRQLEREKALLQHKNAEYQRKADQEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSVLESERRDRTHGSEIINDLQGRISGLEEDLKNGKI
LLAKVEIEKRQLQERFTDLEKEKNNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSILDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLLEMKMS
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLCKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKWKDAQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaagatgcccggcgcccccgaggccgtgtcgggggac
ggcgcgggcgtgagccgccagaggaagctggaggcgctcatccgagaccctcggtcgccc
atcaacgtggagagcttgctggatggcttaaattccttggtccttgatttggatttccct
gctttgaggaaaaacaaaaatatagataatttcttaaatagatatgagaaaattgtgaaa
aagatcagaggtctacagatgaaggcagaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagtccagctggttcgtcataaggcatcacagaaagtttatgctatg
aagcttcttagtaagtttgaaatgataaaaaggtcagattctgcttttttctgggaggaa
cgagatattatggcctttgccaacagtccctgggtggttcagctcttttgtgcctttcaa
gatgataagtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaactatgatgtacctgaaaaatgggccaaattttatactgctgaagttgttctt
gctttggatgccatacactccatgggtttaattcacagagatgtgaagcctgacaacatg
ctcttggataaacatggacatctaaaattagcagattttggcacatgtatgaagatggat
gaaacaggcatggtgcattgtgatacagcagttggaacacctgattatatatcacctgag
gtcctgaaatcacaagggggtgatggttactatgggcgagaatgtgattggtggtctgtg
ggtgttttcctttttgagatgctggtgggggatactccattttatgcagattcactggta
ggaacatatagcaaaattatggatcataaaaactcactatgtttccctgaagatgcagaa
atttctaaacatgcgaagaatctcatctgtgccttcttaacagatagggaggtacgactt
ggaagaaatggggtagaagaaatcaaacaacatcctttctttaagaatgatcaatggaat
tgggataacataagagagacggcagctcctgtggtacctgaactcagcagtgacatagat
agcagcaattttgatgacattgaagatgataaaggagatgtagaaaccttcccaattcct
aaagcttttgtgggaaatcagctgccttttataggatttacctactatagagaaaatttg
ttattaagtgactctccatcttgtaaagaaaatgattcgatacaatcaaggaaaaacgaa
gagagtcaagagattcagaaaaaactatacacattagaagaacaccttagcagtgagata
caagccaaagaggaactagagcagaagtgcaaatctgttaatactcgcctagagaaagta
gcaaaggagctagaagaagagattaccttaaggaaaaatgtggaatcagcattaagacaa
ttagaaagagaaaaggcgcttcttcagcacaaaaatgcagaatatcagcggaaagctgat
caagaagcagacaagaagcgaaatttggagaatgatgttaacagtttaaaagatcaactt
gaagatttgaaaaaaagaaatcagaactctcaaatatccactgagaaagtgaatcaactc
cagagacaactggatgaaaccaatgctttgctgcgaacagaatctgatactgcagcccgg
ttaaggaaaacccaggcagaaagttcaaaacagattcaacagctggaatctaacaataga
gatctgcaagataaaaattgcctgctggagactgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagttctagaatctgaaaggagggaccgaacccatggatcagagatt
attaatgatttacaaggtagaatatctggcctagaagaagatttaaagaatggcaaaatc
ttattagcaaaagtagagattgagaagagacaactacaggagagatttactgatttggaa
aaggagaagaacaacatggaaatagatatgacataccaactaaaagttatacagcagagc
ctagaacaagaagaggctgaacataaggctacaaaagcacggctggcagataaaaataag
atttatgaatccattgaagaagctaaatcagaagccatgaaagaaatggagaaaaagctc
ttggaggaaagaactttaaaacagaaagtagagaacttgttgctggaggctgagaaaaga
tgctctatattggactgtgacctcaaacagtcacagcagaaaataaacgaactcctcaaa
cagaaagatgtgctaaatgaggatgttagaaacttgacattaaaaatagagcaggaaact
cagaagcgctgccttacacaaaatgacttgaagatgcaaacacagcaagttaacacacta
aaaatgtcagaaaagcagttgaaacaagagaataatcatctcctagaaatgaaaatgagc
ttggaaaaacagaatgctgaacttcgaaaagaacgtcaagatgcagatgggcaaatgaaa
gagctccaagatcagcttgaggcagagcagtatttctcaaccctctataaaacacaggtt
agggaacttaaagaagaatgtgaagaaaagaccaaactttgtaaagaattacagcagaag
aaacaggaattacaggatgaaagggactccttggctgctcaactggagattaccttaacc
aaagcagattctgagcaactggctcgctcaattgctgaagaacaatattctgatttggaa
aaagagaaaatcatgaaagagctggagatcaaagagatgatggctagacacaaacaggaa
ctcactgaaaaagatgctacaattgcgtctctcgaagaaactaataggacactgactagt
gatgttgccaatcttgcaaatgagaaagaagaattaaataataaatggaaagatgcccaa
gagcaactttcacggttgaaggatgaagagataagtgctgcagctattaaagcacagttt
gagaagcaactgttaacagagagaacactcaaaactcaagctgtgaataagttggccgag
atcatgaatcggaaagaacctgtcaagcgtggtagtgacacagatgtgcggagaaaagaa
aaggagaatagaaagctacatatggagcttaaatctgaacgtgaaaaactgactcagcag
atgatcaagtatcagaaagaactgaatgaaatgcaggctcaaatagctgaagagagtcag
attcgaattgaactacagatgacactggacagtaaagacagtgacattgagcagttgcgg
tcccagctccaggccttgcatattggtctggatagttccagtataggcagtggaccaggg
gatgctgaagcagatgatgggtttccagaatcaagactagaaggatggctttcattgcct
gtgcgaaacaacactaagaagtttggatgggttaaaaagtatgtgattgtaagtagtaag
aagatccttttctatgacagtgaacaggataaagaacaatctaatccttacatggtttta
gatatagataagttatttcatgtccgaccagttacacagacagatgtatatagagcagat
gctaaagaaattccaaggatattccagatcctgtatgccaatgaaggggaaagtaagaag
gaacaagaatttccagtggagccggtgggagaaaaatcaaattatatttgccacaaggga
catgaatttattcctactctgtatcatttcccaaccaattgtgaggcatgtatgaagcca
ttgtggcatatgtttaaacctcctcctgctttagagtgccgtcgctgtcacattaagtgt
cataaagatcacatggataaaaaggaggaaattatagcaccttgcaaagtgtattatgat
atttcatcggcaaagaatctattgttattagcaaattctacagaagagcagcagaagtgg
gttagtcggttagtgaaaaagatacctaaaaagcctccagctccagacccttttgcacgg
tcatctcctagaacttcaatgaaaatacaacaaaaccagtctattaggcggccaagtcga
cagcttgccccaaacaaaccaagctaa

DBGET integrated database retrieval system