KEGG   Orcinus orca (killer whale): 101279594Help
Entry
101279594         CDS       T05247                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00040  Pentose and glucuronate interconversions
oor00051  Fructose and mannose metabolism
oor01100  Metabolic pathways
Module
oor_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101279594 (SORD)
   00051 Fructose and mannose metabolism
    101279594 (SORD)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101279594 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 101279594
NCBI-ProteinID: XP_004281307
LinkDB All DBs
Position
Unknown
AA seq 356 aa AA seqDB search
MAAAKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFV
VKKPMVLGHEASGTVVKVGSLVKHLKPGDRVAIEPGAPREADEFCKIGRYNLSPTIFFCA
TPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGHKVFVCGA
GPIGLVSLLVAKAMGASQVVVTDLSASRLSKAKEVGADFLLQISNESPQEIANKVEGLLG
CKPEVTIECTGVETSIQAGIYATQSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYC
NTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMIKCDPKDQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaagcccgagaacctctccctggtggtacacggacccggagacctgcgc
ttggagaactatcctatccctgaaccaggcccaaatgaggtgctgctgaagatgcattct
gttggaatctgcggctcagatgtccactactggcagcatggtcgaattggagattttgtt
gtgaaaaagccaatggtgctggggcatgaagcctcaggaacagtcgtaaaagtgggatca
ttggtcaaacacctaaaaccaggtgatcgtgttgccatcgagcctggtgctccccgagaa
gctgatgaattctgcaagattggccgatacaatctgtcaccaaccatcttcttctgtgcc
acgccccctgatgacgggaacctctgccggttctacaagcacaatgctaacttctgctac
aaacttcctgacaatgtcacctttgaggaaggggccctgattgagccactgtctgtgggg
atccatgcctgccggcgagctggagtcaccctggggcacaaggtctttgtgtgcggagct
gggccaattggactggtcagtttgctcgtggccaaagcaatgggtgcatctcaagtggtg
gtgactgatctgtcagcctctcggttgtctaaagccaaggaagttggagctgatttcctc
ctccagatctccaacgagagcccgcaggaaattgccaataaagtggaaggcctgctgggg
tgcaagccagaagttaccatcgagtgcacaggggtggagacctccatccaggcgggcata
tatgccactcaatctggtgggacgctggtgcttgtggggctgggctctgagatgaccagt
gtgcccctagtgcacgcagctaccagggaggtggacatcaagggtgtgtttcgatactgc
aacacgtggccgatggcgatttcaatgcttgcatccaagtctgtgaatgtaaagcccttg
gtaacccatcggtttcctctggagaaagctctggaggcctttgaaacatccaaaaaggga
ttggggttgaaagtcatgatcaagtgcgaccccaaggaccagaatccatga

DBGET integrated database retrieval system