KEGG   Orcinus orca (killer whale): 101279969Help
Entry
101279969         CDS       T05247                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04066  HIF-1 signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04370  VEGF signaling pathway
oor04510  Focal adhesion
oor04926  Relaxin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05219  Bladder cancer
oor05323  Rheumatoid arthritis
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101279969 (VEGFA)
   04015 Rap1 signaling pathway
    101279969 (VEGFA)
   04010 MAPK signaling pathway
    101279969 (VEGFA)
   04370 VEGF signaling pathway
    101279969 (VEGFA)
   04066 HIF-1 signaling pathway
    101279969 (VEGFA)
   04151 PI3K-Akt signaling pathway
    101279969 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101279969 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101279969 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101279969 (VEGFA)
   05206 MicroRNAs in cancer
    101279969 (VEGFA)
   05205 Proteoglycans in cancer
    101279969 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101279969 (VEGFA)
   05211 Renal cell carcinoma
    101279969 (VEGFA)
   05219 Bladder cancer
    101279969 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101279969 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101279969 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101279969 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101279969 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101279969 (VEGFA)
   05165 Human papillomavirus infection
    101279969 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101279969 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101279969 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101279969 (VEGFA)
Cytokines and growth factors [BR:oor04052]
 Growth factors
  Growth factors (RTK binding)
   101279969 (VEGFA)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101279969 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF
Motif
Other DBs
NCBI-GeneID: 101279969
NCBI-ProteinID: XP_004267583
LinkDB All DBs
Position
Unknown
AA seq 214 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEQKPHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMS
FLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSAPCGPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaactttttgctctcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggagagcagaaacctcacgaagtggtg
aagttcatggacgtctaccagcgcagctactgccgtccaattgagaccctggtggacatc
ttccaggagtaccccgatgagatcgagtacatcttcaagccgtcctgtgtgcccctgatg
cggtgtgggggctgctgcaatgacgagggtctggagtgtgtgcccaccgaagagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatgagc
ttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaa
aaatcagttcgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtataaa
tcctggagcgctccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system