KEGG   Orcinus orca (killer whale): 101280638
Entry
101280638         CDS       T05247                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00220  Arginine biosynthesis
oor00330  Arginine and proline metabolism
oor01100  Metabolic pathways
oor04020  Calcium signaling pathway
oor04066  HIF-1 signaling pathway
oor04146  Peroxisome
oor04371  Apelin signaling pathway
oor04926  Relaxin signaling pathway
oor05010  Alzheimer disease
oor05014  Amyotrophic lateral sclerosis
oor05022  Pathways of neurodegeneration - multiple diseases
oor05133  Pertussis
oor05140  Leishmaniasis
oor05142  Chagas disease
oor05145  Toxoplasmosis
oor05146  Amoebiasis
oor05152  Tuberculosis
oor05200  Pathways in cancer
oor05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101280638 (NOS2)
   00330 Arginine and proline metabolism
    101280638 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101280638 (NOS2)
   04066 HIF-1 signaling pathway
    101280638 (NOS2)
   04020 Calcium signaling pathway
    101280638 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101280638 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101280638 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101280638 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101280638 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101280638 (NOS2)
   05014 Amyotrophic lateral sclerosis
    101280638 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101280638 (NOS2)
   05152 Tuberculosis
    101280638 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101280638 (NOS2)
   05145 Toxoplasmosis
    101280638 (NOS2)
   05140 Leishmaniasis
    101280638 (NOS2)
   05142 Chagas disease
    101280638 (NOS2)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101280638 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 101280638
NCBI-ProteinID: XP_004267199
LinkDB
Position
Unknown
AA seq 1157 aa
MACPWQFLFKAKSYKFDLTEEMDINNNVDKAPVSFCSPVTQDDPKCHNLGKHRNESPQPL
TGTAKQSPESLVKPAAPPSACPRHLRIKNWGSGMTFQDTLHHKAKGDLACKSRSCLGAIM
NPKSLTIGPRDKPTLPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPASVELTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVFEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVIEINV
AVLHSFQKHNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDERRRPRRREIRFKVLVKAVLFASVLMREKMASRVRAT
ILFATETGRSETLARDLGALFSCAFNPKVLCMDEYRLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQIAPTGEGD
ELSGQEEAFRGWAVQTFKAACETFDVRGKHHIQIPKLYTANVTWDLHHYRLVQDSQPLDL
NKALGSMHAKHVFTMRLKSQRNLQSPKSSRTTLLVELSCEGSQGPSYLPGEHLGVFPGNQ
PALVQGILERVVDGPAPHQPMRLETLCENGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATDEAERQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PVLKPRYYSISSSRDHAPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSNLKPQDPVPCF
VRSASGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQSGRMTLVFGCRRPD
EDHLYREEMLEMTRKGVLHEVHTAYSRLPDQPKVYVQDILRQQLADEVLHVLHEDQGHLY
VCGDVRAARDVARTLKQLVATALSLTEEQVEDYFFQLKNQKRYHEDIFGAVFPYEVKKDG
AAGLPSNTRAPSAHRRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaatcctataagtttgatttgactgag
gaaatggatatcaacaacaatgtagacaaagcccctgtttccttttgcagtccagtgaca
caggatgaccccaaatgtcacaacctcggcaagcaccggaatgagtctccccagcccctc
acggggacagcgaagcagtctccagaatccctggtcaagccggctgcacccccatcggcc
tgcccacggcacctgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccacaaggccaaaggggatctcgcttgcaagtccaggtcttgcctgggagccatcatg
aaccccaaaagtttgaccataggacccagggacaagcctaccctcccagacgagcttcta
cctcaagctattgaatttgtcaaccagtattatggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgccccccgctgc
attgggaggatccagtggtccaacctgcaggtcttcgacgcgcggagctgttccacggcc
caggagatgttcgagcacatctgcagacacctgcgttatgccaccaacaacggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgacgggaaacatgacttccgggtctgg
aacgcccagctcatccggtatgccggctaccagatgcctgatggtaccatcagaggagac
cctgccagcgtggagctcacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtgcctctggtcctgcaggctgatggccgtgaccctgagctcttcgaa
atccctcccgaccttgtgtttgaggtgcccatggaacatcccaagtatgagtggttccgg
gagctggagctgaagtggtatgccctgccggccgtagccaacatgctgcttgaggtgggt
ggccttgagttcccagggtgccccttcaacggctggtatatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ctggaaacacacaaggtggcctcactctggaaagaccgggctgtcattgagatcaatgtt
gctgtgctccacagtttccagaagcataatgtgaccatcatggaccaccactcagctgca
gagtccttcatgaagtacatgcagaatgagtaccggtcccgagggggttgcccagctgac
tggatttggttggtccccccaatttctggaagcatcacccccgtgttccaccaggagatg
ttaaattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggatgagaggcggagaccccggagaagagagattcgattcaaagtcttggtcaaa
gccgtgctctttgcgtcagtgctgatgcgtgagaagatggcttcccgggtcagagccacg
atcctcttcgcaacagagacaggaagatcagaaacactggcccgggacctaggggccttg
ttcagctgtgccttcaaccctaaggttctctgcatggacgaatacaggctgagccatctg
gaggaggaacagctactgctggtggtgaccagcacgttcgggaacggagactcccctggc
aacggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaagttcagg
tatgccgtgtttggcctcggctccagcatgtaccctcagttctgcgcctttgctcatgac
atcgaccagaagttgtcccagctgggggcttctcagatcgccccaacaggggaaggggac
gagctcagcgggcaggaggaggccttccgtggctgggccgtgcaaaccttcaaggcagcc
tgtgagacgttcgatgtccgaggcaaacaccacatccagatccccaagctctacactgcc
aatgtgacctgggacctgcaccactaccggctcgtgcaagactcacagcctttggacctc
aacaaagccctcggcagtatgcacgccaagcatgtgttcaccatgaggctgaaatcgcag
cggaatctacagagtccaaaatccagccgtaccaccctcctggtggaactctcctgtgag
ggcagccaaggtccaagctacctgccgggagagcacctcggagttttcccaggcaaccag
ccagccctggtccaaggcatcctggagcgagtggtggatggccctgccccccaccaaccc
atgcgcctggagaccctctgcgagaacggcagctactgggtcagggacaagcgactgccc
ccctgctcactcagccaggctctcacctatttcctggacatcaccaccccgccaacccag
ctgctgctccgaaagcttgcccagctggccacggacgaggctgagaggcagaggctggag
accctgtgccagccgtctgattacaacaagtggaagttcaccaatagccccaccttcctg
gaggtgctggaggagttcccgtccctgcgggtgtccgccagcttcctgctctcccagctg
cctgtcctgaagccccggtattactccatcagctcctccagggaccacgcacccacggag
atccacctcaccgtggccgtgctcacgtaccgcacccgagacggccagggtcccctacac
cacggcgtctgcagcacatggctcagcaacctgaagccccaagacccggtgccctgcttt
gtgcgaagtgccagcggcttccagctccccgaggacccctcccacccttgcatcctcatc
gggcctggcacgggcatcgcccccttccgcagcttctggcagcagcggcttcatgatgcc
gagcacaaaggtctccagagcggccgcatgaccctggtgtttgggtgccgccgcccagat
gaggaccacctctaccgggaagagatgttggagatgacccggaagggggtgctgcatgag
gtgcacacagcctattctcgcctgcctgaccagcccaaggtctacgttcaagacatcctg
cggcaacagctggcggacgaggtgctgcacgtgctccacgaggaccagggccacctctac
gtctgcggggacgtgcgcgcagcccgggatgtggcccgcaccctgaagcagctggtggcc
accgcgctgagcctaactgaggagcaggtggaggactatttcttccagcttaagaaccag
aagcgctatcatgaagatatctttggtgctgtatttccctatgaggtgaaaaaggatggg
gcagcggggctgcccagcaataccagagctccaagcgcccacaggagaagttaa

DBGET integrated database retrieval system