KEGG   Orcinus orca (killer whale): 101280933Help
Entry
101280933         CDS       T05247                                 

Gene name
TUBGCP6
Definition
(RefSeq) gamma-tubulin complex component 6
  KO
K16573  gamma-tubulin complex component 6
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oor03036]
    101280933 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:oor04812]
    101280933 (TUBGCP6)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     101280933 (TUBGCP6)
Cytoskeleton proteins [BR:oor04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     101280933 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCP_C_terminal GCP_N_terminal
Motif
Other DBs
NCBI-GeneID: 101280933
NCBI-ProteinID: XP_012392116
LinkDB All DBs
Position
Unknown
AA seq 1666 aa AA seqDB search
MASVPQLVDDLCEALLPAAKAHSGQRRGSRKKAKQSLKRVAYNVLFTSLFQDETRKLQPG
LPRLPVKNRILMLSFDLRVSGLGAEADRLEELVEELEAAHRRPLAELGSVLDLLVRLAGS
GPPRMLRRRRDFFLHSRPVGRDVPYGGYDCADLSGLEADVRSLISGEEYLCRDLVRKTLQ
VMEAAPGTGLPAVGLFSYGDPCGDRFERDTRVSLFGALVHSRTADLDVRLDLPPVPDSAD
LSGLAIKVSSSVDQSEDEGFQSASNLTPDSQSEPGMTPDTDLWDAVLTYEASKRRCWEQV
GCPPGHREEPYLTEAGRAAFDRSCRLCQAGLQVLGGGLLQAPQPVLVKECELVKDALNIL
IGVVSATFSLCQPAQAFTVKQGVHVSGASPESISSLLSEVAECGTHYARLSHFSLQPVLD
SSCSEGLVFQAFTSGLRRYLQYYRACVLSTPPTLSLLTIAFLFKKLGRQLRYLAELCGVG
TGLLGAGGGAPGAAFPTGVKLLSYLYQEALDNCSNEHYPVLLSLLKTSCEPYTRFIHDWV
YSGVFRDVYGEFMIQVNHEYLGFRDKFYWTHGYVLISKEVEDCVPVFLRHVAHDVYVCGK
TINLLKLCCPRHYLCCSDVPVPRVSVIFSLEELKDIEKDCAIYVGRMERVARHSSISKEE
KELRMEIAKQELIVQAREAASRVLSALSDRQLSERMALDAQKREQFQRLKEQFVKDQERR
RAARQEELDDDFSYARELRDRQRRLKALEEQLERKARQALVDHYSKLSAEAARREQKALW
KVQRHRLAGARLRFLLEDQKRVQELLEDMAEGKPLEPLAILPGARFQASFLGPEHPDGGG
SCDPGHEGRHEAAWDSPDRQSVLTPQPLEPPAAGACGSGPGAGPLSEQAEGPGPFSVGLS
IRDFLPTAQGAEQPVLTSAAPVLDEALQTIGSDLPPLAPSAAADTGPSGPQEYDFRTILR
PSVAAPASPGALQTAGGSLGSEGQRLREDTHVQLDTCVPDGRVALPYAHPPQHPSCQEES
SQDPGQLCGQVAEPGVPTEGYASGMAPARPRWNVHGHVSDASIRVGENVWDVAPSRPRWN
VHGHVSDASIRVGENVWDVAPSRPRWNVHGHVSDASIRVGENVWDVAPSRPRWNVHGHVS
QSSVMLGLLSGEAEPNVPGPPWAPPDHGSRSGLSLGAQSPAREDEPRLPAETASGGSGRG
EETGLQDLLSAEAAPTALEDSIPEEPGPGASGDSQDLSPSGPPSSQEGVDTRSSPGPGEE
AAQRWDREQAYLAGLAGQYCLERYPDSYEAMSEPPVARLLHHGLPRAFALPEDPGAQSDA
DASAVQLSELLPLPVLMKHSITAPLAAHVSLVNKAAVDYFFVELHLGAHFEALRHFLLME
DGEFAQSLSDLLFEKLGAGQTPGELLSPLVLNSVLSKALQYSLHGDTPHAANLSFALKFL
PETFAPNAPDVLSCLELRYKVDWPLNIVVTEGCLSRYSGIFSFLLQLKLMMWTLKDVCFH
LKRTARVSHAAGSVQFRQLQLFKHEMQHFVKVIQGYIANQILHVTWCEFQARLASVGDLE
DIQRAHAEYLHKAVFRGLLTEKAAPVMNIIHSTFSLVLKFRSQLIAQPWRGPEHPNFALL
QQSYSTFKYYSHFLFKVVSKLVNRGYQPHLEDFLLRINFNSYYQDA
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtcccccagctggtggacgacctgtgcgaggccctcctgccggccgcgaag
gctcactctggccagcgccgcgggagccgcaagaaggccaagcagagcctcaagagggtg
gcctacaacgttctgttcacgagcctctttcaagatgagacccgcaagctgcagcccggc
ctcccgagactcccggtgaaaaacaggatcctcatgctgtccttcgacttgcgagtgagc
ggcctgggcgccgaggccgaccgcctggaggagttggtggaggagctggaggccgcgcat
cgccggccgctggcggagctgggatccgtgctggacctgctggtgcggctggcgggcagc
gggcccccgcgaatgctgcggcgccggcgggacttcttcctgcacagccggcccgtcggg
agagacgttccctacggcggctacgactgcgccgatctgagcgggttggaggcggacgtg
cggtcactcatctccggagaggagtatctgtgtcgggacctggtccggaagacgctgcag
gtgatggaggcggcgccgggcaccggcctgcccgccgtcgggctcttctcgtatggcgac
ccctgcggggacaggtttgagagggacacccgcgtctcgctctttggagccctggtgcac
agccgcacggccgacctggacgtccgcctggacctgcccccggtgccggacagcgcagac
ctctccggactggccatcaaggtctcttcgagtgtggatcagtcggaagatgaagggttt
caatcggcatccaatctgactcctgactcccagtctgagccgggcatgactccagacacc
gacctgtgggacgccgtgctcacctacgaggccagcaagcggaggtgctgggagcaagtt
ggatgcccgcctggccaccgagaggagccctacctcaccgaggccggaagggccgccttc
gacaggtcctgccggctctgccaagcagggctgcaggtgctgggcgggggcctcctgcag
gccccgcagcccgtcctggtgaaggagtgcgagctggtgaaggacgcgctcaacatcctg
attggggtcgtgtccgccacgttttccctctgccagccagcgcaggccttcacggtgaag
cagggtgtccacgtctcaggagcatcccccgagagcatcagcagcctcctctcggaggtg
gctgagtgcgggacgcactacgcgcgcctgagccacttctctctgcagcctgtgctggac
tcctcgtgcagcgagggcctcgtgttccaggccttcaccagcggcctgaggaggtacctg
cagtactaccgggcctgcgtgctctccaccccgcccaccctgagcctcctcaccattgcc
tttctcttcaagaaactgggccggcagctcaggtacctggctgagctctgcggtgtcggc
actggactcctgggtgctgggggcggagcgcccggggctgcgttccccactggggtgaag
ctgctctcctacctctaccaggaggccctggataactgcagcaacgagcactacccggtc
ctgctgtctctgctgaagaccagctgcgagccctacacgcggttcatccacgactgggtg
tacagtggggtcttcagagacgtttacggcgagttcatgatccaggtgaaccacgagtac
ttgggcttcagagataagttttactggacccacggctacgtgcttatttccaaagaggtg
gaggactgcgtccccgtgttcctgaggcacgtcgcccacgacgtgtatgtctgcgggaag
accatcaacctgctgaagctctgctgcccccggcattacctctgctgctccgatgtcccg
gtccctcgcgtctcggtgatattctccctcgaggagctgaaggacatcgagaaggactgt
gccatctacgtgggccggatggagagggtggcgcgccacagctccatcagcaaggaggag
aaggaattacgaatggaaattgcaaaacaagaattaatcgtccaggcccgggaagcggcg
tccagggtcctgagcgcgctcagcgatcggcagctgtctgagcggatggccttggatgcc
cagaagcgagagcagtttcagaggctgaaggagcagtttgtgaaggaccaggagcgccgc
cgggcggccaggcaggaggagctggatgatgacttcagctacgcccgtgagctccgggac
cggcagaggaggctgaaggccctggaggagcagctggagaggaaggccaggcaggccctg
gtggatcattacagcaagttgtctgcagaggcagctcgtcgggagcagaaggcgctgtgg
aaggtccagaggcacagattggccggcgctcggcttcgttttctcttagaagatcagaaa
cgcgttcaggagctgctggaagacatggcggaggggaagcccctggagccgttggccatc
ctcccgggtgcccgcttccaggcttcctttctgggccctgagcaccccgacggaggcggc
agctgtgatcctgggcatgaggggcggcatgaggctgcctgggacagccccgacaggcag
agcgtgctgacgccgcagcccctcgagcctccagcagctggggcctgcggctcagggcca
ggagcaggcccgctgtcagagcaggcggaggggccggggccgttctctgtgggcctcagc
atccgagacttcctgcccacggcccagggggctgagcagcctgtgctcaccagcgcggcc
cccgtcctggacgaggcgctgcagaccattggctcggacctgcctcccctggctccgtcc
gcagcagcggacacagggccctccgggccacaggagtacgatttcagaaccatcctgagg
ccgtctgtggccgctccagcttccccaggggccctgcagactgcaggaggcagcttgggc
agtgaggggcagcggctgcgggaggacactcacgtgcagctggacacatgtgtcccagat
gggcgggtggctctgccttacgcgcaccccccccagcacccctcctgccaggaggagagc
agccaggacccggggcagctctgcgggcaagtggcagagcctggtgttcccacagagggt
tatgcttctggaatggctcccgcccggccacggtggaacgtccacggacacgtgtctgat
gccagcatcagggtgggggagaacgtgtgggatgtggccccctcccggccacggtggaac
gtccacggacacgtgtctgatgccagcatcagggtgggggagaacgtgtgggatgtggcc
ccctcccggccacggtggaacgtccacggacacgtgtctgatgccagcatcagggtgggg
gagaacgtgtgggatgtggccccctcccggccacggtggaacgtccacggacacgtgtct
cagtccagtgtgatgctggggttgctctcaggggaagctgagcccaacgtgcccgggccc
ccctgggcgccccctgaccatgggtcccggtcaggcctcagcttgggagcccagagccct
gcccgggaagacgagccacggctgcctgcagagacggcctcaggcggctctggccgtggg
gaggagactggcctgcaggacttgctgtctgcggaggctgcgcccactgcgctggaagac
agtatccctgaggagccaggcccgggggcgagtggggactcccaggacctctctccaagt
ggccctccgagctcacaggagggcgtagacacccggagcagcccaggccctggcgaggag
gcggcccagcgctgggacagggagcaggcctacctggcaggcctggcggggcagtactgc
ctggagcggtacccggacagctacgaggccatgtcagagcctcccgttgcccgcctcctg
caccacgggctgccccgagcttttgccctccccgaggaccccggggcccagtcagacgca
gacgcgagtgcagtgcagctgagcgagctgctgccgctgcccgtgctcatgaagcactcc
atcacggccccgctggctgcccacgtctccctggtgaacaaggccgcagtcgactacttc
ttcgtggagctgcacctcggggcacacttcgaggcgctgcggcacttcctgctgatggag
gacggggagtttgcgcagtccctcagcgacctgctcttcgagaagctcggggcgggacag
acgcctggggagctcctcagcccgctggtgctcaactccgtgctgagcaaggccctgcag
tacagcctgcacggcgacacgccgcacgccgccaacctctccttcgccctcaagttcctg
cccgagacctttgcccccaatgccccggacgtgctgagttgcctggagctcaggtacaag
gttgactggcccctcaacatcgtggtcaccgagggctgcttgagcaggtacagcggcatt
ttctccttcctgttgcagctgaagctcatgatgtggacactcaaggatgtctgcttccac
ctcaagcgcacagcacgggtgagccacgcagccggctcggtgcagttccgccagctacag
ctgttcaagcatgagatgcagcacttcgtgaaggtcatacagggctacatcgccaaccag
atcctgcatgtcacctggtgtgagttccaggccaggctggcctcggtgggcgacctagag
gacatccagcgcgcccatgccgagtacctgcacaaggctgtgttcaggggcctgctgacg
gagaaggcggcgccggtcatgaacatcattcacagcaccttcagcctggtgctcaagttc
cgcagccagctcatcgcccagccctggcgcggccccgagcaccccaacttcgccctcctg
cagcagtcctacagcaccttcaagtactactcccacttcctcttcaaagtggtgagcaag
ctggtgaaccgcggctaccagccccacctggaggacttcctgctgcgcatcaacttcaac
agctactaccaggacgcctga

DBGET integrated database retrieval system