KEGG   Orcinus orca (killer whale): 101281088Help
Entry
101281088         CDS       T05247                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04061  Viral protein interaction with cytokine and cytokine receptor
oor04630  Jak-STAT signaling pathway
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101281088 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101281088 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101281088 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101281088 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101281088 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101281088 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oor04050]
    101281088 (IL10RA)
   04090 CD molecules [BR:oor04090]
    101281088 (IL10RA)
Cytokine receptors [BR:oor04050]
 Interleukin receptor families
  IL10/28 receptor family
   101281088 (IL10RA)
CD molecules [BR:oor04090]
 Proteins
  101281088 (IL10RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac
Motif
Other DBs
NCBI-GeneID: 101281088
NCBI-ProteinID: XP_012389778
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MGAVRMPATITTIISSLAGRWRGPLLALVLTLFSLRTELPRPSSAWFEAEFFYHVLHWTP
IPNQSESTYYEVELLRYGVEPIYWNPIRSCSQTLVLSCDLTMQTLDLYHSNGYRARVRAV
DGGQHSNWTSPNTRFSVDEVTLTVAGVKLEVHDGIIFGVIQLPRPKMAPAGNTYESIFHN
FREYEIEVRKVPGRYKSHDKIKHENFNLPVPRGVGEFCVRVKPSVSSRVNKEVWSKEECI
VLTPQYFTVTNLSIFFTFVLLLCGALAFFLALQLYVQRRGKLPTVLVFKKPSPFSLISQL
SCPETQDTIHPLDEQAFPKVSPELRNSELHGSTDSGFSSAKPSLQTDEPQFHLPAPHPQA
GGTLGKGAPRLPEDSCSSGGSKSTDSGICLQEPSLSPGTEPSWEPQAGSDSRDQLDSGIG
LVQNPEGQPEDVQGGSALGPVSPLGPEVAAGEDPAAGAFQGYLKQTRCPEERAAEAGGLE
EESSSTDGLGPKFKTCVDAEVDWPLPALAKGYLKQDPPEMTLTPSGAPAGQWNPPTEDWS
LLGLTRCGDLGASDWSFAHDLAPLDCVAAPGGLLGSFDSDLVALPLISSLHSSE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgttagaatgcctgccaccatcaccaccatcatctcctccctggcggggagg
tggaggggacctctgctagctctggtactgacactgttctccctgcggacagaactgccc
agaccttcatctgcgtggtttgaagcagaatttttctaccacgtcctccactggactccc
atcccgaatcagtctgaaagtacctactatgaagtggagctcctgcggtatggagtagag
cccatctactggaaccccatccgcagctgtagccaaaccttggtgctgtcctgtgatctc
accatgcagaccctggacctgtatcatagcaatggttaccgagccagagtccgggcagtg
gacggaggccagcactcaaactggacctctcccaacacccgcttctctgtggatgaagtg
actctgacagttgccggcgtgaagctagaggtgcacgatggcatcatctttggggtgatc
cagctccccaggcccaagatggcccctgcaggcaacacatatgaaagcatcttccacaac
ttccgggagtatgagattgaggttcgcaaggtaccaggacgatataagtcccatgacaag
ataaaacatgaaaactttaacctcccagtcccgagaggggtgggagagttctgtgtcagg
gtgaaaccatctgtcagctcccgagtgaacaaggaggtctggtccaaggaggagtgcatc
gtgctcaccccgcagtatttcaccgtgaccaacctcagcatcttcttcacctttgtcctg
ctgctctgtggagccctggccttcttcctggccctccagctgtatgtgcagcgccggggg
aagctgcccaccgtcctggtcttcaagaagcccagtcccttcagcctcatcagccagctt
tcctgcccagagacccaagacaccattcaccccctcgatgagcaggccttccccaaggtg
tccccagagctgaggaactcggagctgcacggcagcacggacagtggcttcagcagtgcc
aagccatccctgcagactgatgagccccagttccacctccctgccccccacccccaggct
gggggtactttgggaaagggggcgccccggttgccagaggacagctgcagtagcggcggc
agcaaaagtacagacagcgggatctgcctgcaggagcccagcctgagtcctggcacggag
cccagctgggagccgcaggcggggagcgacagccgggaccagcttgacagtggcattggc
ctggtccagaaccctgaggggcagcctgaggatgttcagggtggctcagctttgggccct
gtgagtcccctgggaccggaggtggctgcgggagaagacccagctgcaggggccttccag
ggctacctgaagcagacccggtgcccggaggagagggcagccgaggcaggcggcctggaa
gaagagtcctcctcaacagatggccttggccccaaattcaagacatgcgtggatgctgag
gtggactggcctctaccagccctggccaagggctatttgaaacaggaccccccagaaatg
actctcactccctcaggggccccagctggacagtggaacccaccaactgaggattggtca
ctcctgggcttgacccgctgtggtgaccttggagcatctgactggagctttgcccacgac
cttgcccctctggactgtgtggcagccccaggcggtctcctgggcagctttgactcagac
ctggtcgccctgccactcatctccagcctgcactcaagtgagtga

KEGG   Orcinus orca (killer whale): 101283710Help
Entry
101283710         CDS       T05247                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04061  Viral protein interaction with cytokine and cytokine receptor
oor04630  Jak-STAT signaling pathway
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101283710 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101283710 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101283710 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101283710 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101283710 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101283710 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oor04050]
    101283710 (IL10RB)
   04090 CD molecules [BR:oor04090]
    101283710 (IL10RB)
Cytokine receptors [BR:oor04050]
 Interleukin receptor families
  IL10/28 receptor family
   101283710 (IL10RB)
CD molecules [BR:oor04090]
 Proteins
  101283710 (IL10RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac zf-MIZ Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 101283710
NCBI-ProteinID: XP_004264570
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MAQSLRSWLGGCLLVSALGMVPPPENVRMNSVNFRNILQWESPAFPKGNLTFTAQYQSYR
KFQDICTSTVLTECDFSSLSKYGDHTLRVRAQFEDEHSDWINITFCPVDDTIIGPPRIQV
EALANSLHMRFLAPKIKNEPETWSMRNIYNSWTYHVQYWKNGSDEKFPVTGQYDFEVLRN
LESQTTYCVQVRGFLPDRNKTGEWSEPVCEQTTADEIAPTWIVAGVLGASVCTALLTLTG
CFVLLRCVYKKAKHAIPPRNSLPQHLKEFLNHPHHSTLLLFSFPLSEENEVFDKLSVITE
VCESHKPNLGAGCSLRTLSGQGSSELASKEETHSAGHSDPLLLTPASGGDQSNRQTRAET
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagagcctccggagctggctgggcggctgcctcctggtgtcagcattaggaatg
gtgccacctcctgaaaatgtcagaatgaattcagttaatttcaggaacattctacagtgg
gagtcgcctgcttttcccaaggggaacctgactttcacagctcagtaccaaagttacagg
aaattccaagatatatgcacaagtactgtcttgacggaatgtgatttctcaagtctttcc
aagtatggtgaccacaccttgagggtcagggctcaatttgaagacgagcattcagactgg
ataaacatcaccttctgtcctgtggatgacaccattatcggacctcccagaatccaagta
gaagcacttgctaattctttacatatgcgtttcttagccccgaaaattaagaatgaacct
gaaacatggagcatgaggaatatttataactcatggacttatcatgtgcaatattggaaa
aatggctcagacgaaaagtttccagttactggtcagtatgacttcgaggtcctccgaaat
cttgagtcacagacaacttactgtgttcaagttcgagggtttcttcctgatcggaacaaa
actggggagtggagtgagcctgtctgtgagcaaacaactgctgacgaaatcgcccccacc
tggatcgtggccggggtcctgggagcctcggtgtgcaccgccctcctgacgctcactggc
tgcttcgtcttgctgcgatgcgtttacaagaaagccaagcatgccatccccccgaggaat
tctcttccacagcacctgaaagagtttctgaaccaccctcatcacagcacacttctctta
ttctccttcccactgtctgaggagaatgaagtttttgacaaactgagcgtcatcacagaa
gtgtgtgaaagccacaagccgaaccttggggcgggctgcagccttaggaccttgtctggg
caggggtcctctgagctggcctccaaggaggaaacacactcagccgggcacagcgacccc
ctccttctcacgcctgcctctgggggtgatcagagcaaccgacaaacaagggctgagacc
agctga

DBGET integrated database retrieval system